KEGG   Serratia fonticola DSM 4576: WN53_16920Help
Entry
WN53_16920        CDS       T04030                                 

Definition
(GenBank) glutathione S-transferase
  KO
K11209  GSH-dependent disulfide-bond oxidoreductase [EC:1.8.4.-]
Organism
sfw  Serratia fonticola DSM 4576
Brite
Enzymes [BR:sfw01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.4  With a disulfide as acceptor
    1.8.4.-  
     WN53_16920
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_N GST_N_3 GST_N_2 GST_C GST_C_3 GST_C_2 GST_C_6
Motif
Other DBs
NCBI-ProteinID: AKG70659
UniProt: A0A0F7HCK5
LinkDB All DBs
Position
complement(3791163..3791870)
Genome map
AA seq 235 aa AA seqDB search
MSDINQFPIAKRWPAKHPERLQLYSLPTPNGVKVSIMLEEIGLPYEAHLIDIGKNETWTP
EFLSLNPNGKIPAILDPAGPDGKPLALFESGAILLYLAEKCGQLLPKDPAQRYETIQWVF
FQMASVGPMFGQLGFFHKFAGREYEDKRPFERYQKESKRLLGVLEERLQGRDWIMGAEYT
IADISLLGWVRNLIGFYEARDVVEFDSFPLVGQWLERGLARPAVQRGINIPARQA
NT seq 708 nt NT seq  +upstreamnt  +downstreamnt
atgtccgatattaaccaattcccgatcgccaaacgttggcccgccaagcatcctgaacgt
ttacaactctactcgctgccgacccctaatggggtgaaagtctccatcatgctcgaagag
atcggcctgccctatgaggcgcatctgatcgacatcggcaaaaatgaaacctggacgccg
gagttcctgtcgctcaatcctaacggtaaaatcccggcgatcctcgatcctgcgggccca
gacggtaagccgttagcgctgttcgaatccggggctatcctgctgtatctggcagagaaa
tgcggccagttgttacccaaggatcccgcccagcgttatgaaaccatccagtgggtgttt
ttccagatggcatccgttgggccgatgtttggccagctaggcttcttccacaaattcgcc
ggacgtgaatatgaagacaaacggccatttgaacgctaccaaaaggagtccaaacggctg
ctgggtgtgctggaagaacggctgcaagggcgtgattggatcatgggtgcggaatacacc
attgccgatatctccctgcttggctgggtacgcaacctgattggtttttatgaagcgcgc
gacgtggtggagttcgacagcttcccgctcgtgggccaatggctggaacgtggactggca
aggccagccgtacagcgcggtatcaatattcctgcccgccaagcctga

DBGET integrated database retrieval system