KEGG   Serratia fonticola DSM 4576: WN53_18595
Entry
WN53_18595        CDS       T04030                                 

Definition
(GenBank) membrane protein
  KO
K11910  type VI secretion system protein VasJ
Organism
sfw  Serratia fonticola DSM 4576
Brite
KEGG Orthology (KO) [BR:sfw00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:sfw02044]
    WN53_18595
Secretion system [BR:sfw02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   WN53_18595
SSDB
Motif
Pfam: T6SS_VasJ ImpA_N MafB
Other DBs
NCBI-ProteinID: AKG70969
UniProt: A0A0F7HF58
LinkDB
Position
4193120..4194514
AA seq 464 aa
MDSTSQHPWHALLLTPLTPEQTAKALADDDPQWEHIDSQMVKVGSLTHSSLNIDDLQQQA
MALLSQKSKDFRLVVHLLRTLQHGGEPGDLMLAISLLTAYVQNFWTSAWPLNPLHKRRFA
QQILKRFDSASGSFSQRATDAQRQDVQGLLAHLAQVWHSEEPALAKEVDSLRTSYARLPT
RTVEPVVEEEERPQSGSASTSTSASRTISPSLSIDSSSDKAWRQTLLKMADLLCELHPEA
AIGFRLRRHALWGSLTAPPIAQADGRTPLAAVSVDRMADYLGRVATSDLALWQQVEQSLA
LAPYWLDGHALSAQIAIRLGYAGVAQAIRDELSAFIERMPALTTLYFTDMTPFLSPESAS
WLQQDTGTNGGGNTIEQDEIWQCYQQQGLEAALQMVDRQSQQAEPRDRFYLQLLSAQLLE
KAGMTALAQQHYHNLLQVGQQVQLSEWEPALIALLTDKQRQLKP
NT seq 1395 nt   +upstreamnt  +downstreamnt
atggatagcacgtcacaacatccctggcatgcattattgctgacaccgctgacgcccgag
cagaccgccaaggcgttggccgatgacgatccgcaatgggagcatatcgacagccagatg
gtcaaagtgggttcgctgacccacagctcgctgaatattgatgaccttcagcagcaggcg
atggctctgttgtcgcaaaaaagcaaagacttccgcttggtggtgcacctgctgcgtacc
ttgcagcacggcggcgagccgggcgacctgatgctggcgatctccttgctgaccgcttac
gtgcagaacttctggaccagcgcctggccgttgaacccgctgcataagcgccgctttgcc
cagcagatcctcaagcgttttgacagcgccagcggcagctttagccaacgggcgacggat
gcccaacgccaggatgtgcaaggtttgctggcacatctggcccaggtctggcacagcgag
gaaccggccctggcgaaagaggtggatagcctgcgcaccagctatgcgcggttgcctact
cgcaccgttgaaccggtagttgaggaggaagaacgccctcagtctggttcggcatcgaca
tcaacctctgccagcagaacgatcagccccagtctgagcattgatagctccagcgataaa
gcctggcggcaaacgctgctgaaaatggcggatttactgtgtgaactgcaccccgaggcc
gccattggttttcgcctgcgtcgccatgccctgtggggcagcttgactgcaccaccgata
gcgcaggccgatgggcgcacgccgctggcagccgtttctgtcgatcgcatggccgattat
ctggggcgcgtggccacttcggatctggccctgtggcaacaggtagaacaaagcctggcg
ctggcgccttactggctggatggccacgcgctttcggcgcagatcgctattcggctggga
tacgcaggggttgcgcaggccatacgcgacgaactgagcgcctttatcgagcggatgccg
gcgttaactaccctttattttaccgatatgacgccattcctctcccctgaatctgccagc
tggttacagcaggatacgggtaccaatgggggaggtaacactattgaacaggatgaaatt
tggcaatgctatcaacagcaaggactggaagccgcgttacagatggtcgatcggcaatcg
cagcaagccgaacccagggaccgtttttacctgcaattgctcagcgcccagttactggaa
aaagcggggatgacggcgctggcacagcagcactaccacaacctgttgcaggtggggcag
caagtgcagctaagcgaatgggaaccggcgttgatcgccttgctgacagacaagcagcgg
cagctcaagccgtga

DBGET integrated database retrieval system