KEGG   Serratia fonticola DSM 4576: WN53_20240Help
Entry
WN53_20240        CDS       T04030                                 

Definition
(GenBank) superoxide dismutase
  KO
K04565  superoxide dismutase, Cu-Zn family [EC:1.15.1.1]
Organism
sfw  Serratia fonticola DSM 4576
Brite
Enzymes [BR:sfw01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     WN53_20240
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Cu
Motif
Other DBs
NCBI-ProteinID: AKG71267
UniProt: A0A0F7HF73
LinkDB All DBs
Position
4564807..4565331
Genome map
AA seq 174 aa AA seqDB search
MKRYWCAALGLMACGVAQAATVDVEMNLVTGQGIGQDIGKITISETPYGLLFTPQLKALP
AGVHGFHVHEKGSCEPGMKDGKAVAALAAGGHFDPEKTSKHLGPYDANGHLGDLPAIYVT
ADGMADTQVLAPRLKKISEIEGKALMVHAGGDNHSDQPKPLGGGGDRFACGVIK
NT seq 525 nt NT seq  +upstreamnt  +downstreamnt
atgaaacgttattggtgtgcggcattgggtttgatggcctgtggcgttgcgcaggcggca
acggttgatgtcgaaatgaatctggtgaccggccagggaattggtcaggacattggtaaa
atcacaattagcgaaacgccttatggcctgttgtttaccccgcagctgaaagccttgcct
gctggtgtgcacggttttcacgttcatgagaaaggcagttgtgagccgggtatgaaagac
ggcaaggcggtagccgcactggctgcgggtggccactttgaccctgaaaaaaccagcaag
catctcgggccttatgatgccaacgggcatttaggcgatttgccagcaatctatgtcacg
gcggacggtatggctgacacccaggtcctggctccgcgcttgaagaaaatcagcgaaatc
gaaggcaaagcgctgatggtacacgccgggggggataaccactccgatcaacccaagcct
ctgggtggtggtggcgatcgcttcgcctgtggcgtaatcaaataa

DBGET integrated database retrieval system