KEGG   Serratia fonticola DSM 4576: WN53_25515Help
Entry
WN53_25515        CDS       T04030                                 

Definition
(GenBank) catalase
  KO
K03781  catalase [EC:1.11.1.6]
Organism
sfw  Serratia fonticola DSM 4576
Pathway
sfw00380  Tryptophan metabolism
sfw00630  Glyoxylate and dicarboxylate metabolism
sfw01100  Metabolic pathways
sfw01110  Biosynthesis of secondary metabolites
sfw01130  Biosynthesis of antibiotics
sfw01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:sfw00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    WN53_25515
  09105 Amino acid metabolism
   00380 Tryptophan metabolism
    WN53_25515
Enzymes [BR:sfw01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.6  catalase
     WN53_25515
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Catalase Catalase-rel
Motif
Other DBs
NCBI-ProteinID: AKG72206
UniProt: A0A0F7HHB2
LinkDB All DBs
Position
5737281..5738717
Genome map
AA seq 478 aa AA seqDB search
MSKKGLTTAAGAPVVDNNNVITAGKRGPMLLQDVWFLEKLAHFDREVIPERRMHAKGSGA
YGTFTVTHDITKYTRAKIFSEIGKQTEMFVRFSTVAGERGAADAERDIRGFAMKFYTEEG
NWDLVGNDTPVFYLRDPLKFPDLNHVVKRDPHTNLRNPVYKWDFFSHLPESLHQLTIDFS
DRGLPKSYRHMHGFGSHTFSFINANNERFWVKFHFRCEQGIENLMDDEAEAIIAKDRESS
QRDLFDSIKNGDFPRWKLQIQIMPEHEASQTPYNPFDLTKVWPHGDYPLIDVGFFELNRN
PDNYFSEVEQVAMNPANVVPGVSFSPDKMLQGRLFSYGDAHRYRLGVNHHQIPVNGAKCP
FHNYHRDGAMRVDGNSGNGATYEPNSFGVFQEQPDFSEPPLSIEGAADHWNHREDDDYYS
QPRALFNLLSAEEHQRMFTRIAGELSQVPEQIQRRQVELFTKVHPDYGNGVAKALGLK
NT seq 1437 nt NT seq  +upstreamnt  +downstreamnt
atgagcaagaaaggattaactaccgcggctggcgcgcccgttgttgataataataacgtg
atcaccgccggcaagcgcggcccgatgctacttcaagacgtttggttcctggaaaaactg
gcccactttgaccgcgaagtgatcccagagcgtcgtatgcacgccaaggggtccggagct
tacggcacctttaccgtcacccacgatataaccaagtacacccgcgcaaaaatcttctct
gagattggtaagcaaaccgagatgttcgtccgcttctctaccgttgccggtgagcgcggg
gctgccgacgccgaacgtgatatccgcggctttgccatgaagttctataccgaagaaggt
aactgggatctggtcggtaacgataccccggtgttctacctgcgcgatccgctgaaattc
cctgacctgaaccacgtagtaaaacgcgatccgcacaccaacctgcgcaatccggtgtac
aaatgggacttcttctcccatctgcctgaatcactgcaccagttgaccatcgacttcagc
gaccgcggcctgcctaaatcctaccgtcatatgcacggtttcggcagccataccttcagt
tttatcaacgccaataacgagcgtttctgggtcaaattccacttccgctgtgagcaaggc
atcgaaaacctgatggacgatgaagcagaagccatcatcgccaaagatcgtgaaagttcg
cagcgcgatctgttcgattccatcaagaacggtgacttcccgcgctggaaactgcaaatc
cagatcatgccagagcatgaagcgtcacaaaccccgtataacccgtttgacctgaccaaa
gtctggccgcacggcgactacccgctgatcgatgtcggcttcttcgaactgaaccgcaac
ccggataactacttctccgaagtagaacaagtggccatgaacccggctaacgtggtgcct
ggcgtcagcttctccccggataaaatgttgcagggccgtctgttctcctatggcgatgca
caccgctaccgcctgggcgtcaaccatcaccaaatcccggtcaacggtgccaaatgtccg
ttccataactatcatcgcgatggggctatgcgagtggatggtaacagcggcaacggcgca
acctatgagccaaacagctttggggtgttccaggagcagccagatttcagcgaaccgcca
ttgagcatcgaaggtgccgccgatcactggaatcatcgtgaagacgacgattactacagc
caaccgcgcgcgctgttcaatctgctgagtgccgaggagcaccaacgtatgttcacccgt
atcgccggtgagttgtcgcaggtgccagaacagatccaacgtcgtcaggttgagttgttc
accaaagtacatcccgattacggtaacggcgtagccaaggccttgggcctgaaataa

DBGET integrated database retrieval system