KEGG   Shigella flexneri 2457T (serotype 2a): S1375Help
Entry
S1375             CDS       T00128                                 

Gene name
fabI
Definition
(GenBank) enoyl-[acyl-carrier-protein] reductase (NADH)
  KO
K00208  enoyl-[acyl-carrier protein] reductase I [EC:1.3.1.9 1.3.1.10]
Organism
sfx  Shigella flexneri 2457T (serotype 2a)
Pathway
sfx00061  Fatty acid biosynthesis
sfx00780  Biotin metabolism
sfx01100  Metabolic pathways
sfx01130  Biosynthesis of antibiotics
sfx01212  Fatty acid metabolism
Module
sfx_M00083  Fatty acid biosynthesis, elongation
sfx_M00572  Pimeloyl-ACP biosynthesis, BioC-BioH pathway, malonyl-ACP => pimeloyl-ACP
Brite
KEGG Orthology (KO) [BR:sfx00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    S1375 (fabI)
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    S1375 (fabI)
  09110 Biosynthesis of other secondary metabolites
   00333 Prodigiosin biosynthesis
    S1375 (fabI)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:sfx01004]
    S1375 (fabI)
Enzymes [BR:sfx01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.9  enoyl-[acyl-carrier-protein] reductase (NADH)
     S1375 (fabI)
    1.3.1.10  enoyl-[acyl-carrier-protein] reductase (NADPH, Si-specific)
     S1375 (fabI)
Lipid biosynthesis proteins [BR:sfx01004]
 Fatty acid synthase
  Component type
   S1375 (fabI)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: adh_short_C2 adh_short KR
Motif
Other DBs
NCBI-ProteinID: AAP16787
UniProt: P0AEK6
LinkDB All DBs
Position
complement(1344389..1345177)
Genome map
AA seq 262 aa AA seqDB search
MGFLSGKRILVTGVASKLSIAYGIAQAMHREGAELAFTYQNDKLKGRVEEFAAQLGSDIV
LQCDVAEDASIDTMFAELGKVWPKFDGFVHSIGFAPGDQLDGDYVNAVTREGFKIAHDIS
SYSFVAMAKACRSMLNPGSALLTLSYLGAERAIPNYNVMGLAKASLEANVRYMANAMGPE
GVRVNAISAGPIRTLAASGIKDFRKMLAHCEAVTPIRRTVTIEDVGNSAAFLCSDLSAGI
SGEVVHVDGGFSIAAMNELELK
NT seq 789 nt NT seq  +upstreamnt  +downstreamnt
atgggttttctttccggtaagcgcattctggtaaccggtgttgccagcaaactgtccatc
gcctacggtatcgctcaggcgatgcaccgcgaaggagctgaactggcattcacctaccag
aacgacaaactgaaaggccgcgtagaagaatttgccgctcaattgggttctgacatcgtt
ctgcagtgcgatgttgcagaagatgccagcatcgacaccatgttcgctgaactggggaaa
gtttggccgaaatttgacggtttcgtacactctattggttttgcacctggcgatcagctg
gatggtgactatgttaacgccgttacccgtgaaggcttcaaaattgcccacgacatcagc
tcctacagcttcgttgcaatggcaaaagcttgccgctccatgctgaatccgggttctgcc
ctgctgaccctttcctaccttggcgctgagcgcgctatcccgaactacaacgttatgggt
ctggcaaaagcgtctctggaagcgaacgtgcgctatatggcgaacgcgatgggtccggaa
ggtgtgcgtgttaacgccatctctgctggtccgatccgtactctggcggcctccggtatc
aaagacttccgcaaaatgctggctcattgcgaagccgttaccccgattcgccgtacagtt
actattgaagatgtgggtaactctgcggcattcctgtgctccgatctctctgccggtatc
tccggtgaagtagtccacgttgacggcggtttcagcatcgctgcaatgaacgaactcgaa
ctgaaataa

DBGET integrated database retrieval system