KEGG   Shigella flexneri 2457T (serotype 2a): S1867Help
Entry
S1867             CDS       T00128                                 

Gene name
gadB
Definition
(GenBank) glutamate decarboxylase isozyme
  KO
K01580  glutamate decarboxylase [EC:4.1.1.15]
Organism
sfx  Shigella flexneri 2457T (serotype 2a)
Pathway
sfx00250  Alanine, aspartate and glutamate metabolism
sfx00410  beta-Alanine metabolism
sfx00430  Taurine and hypotaurine metabolism
sfx00650  Butanoate metabolism
sfx01100  Metabolic pathways
sfx01110  Biosynthesis of secondary metabolites
sfx01120  Microbial metabolism in diverse environments
sfx02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:sfx00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    S1867 (gadB)
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    S1867 (gadB)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    S1867 (gadB)
   00430 Taurine and hypotaurine metabolism
    S1867 (gadB)
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    S1867 (gadB)
Enzymes [BR:sfx01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     S1867 (gadB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyridoxal_deC Aminotran_5
Motif
Other DBs
NCBI-ProteinID: AAP17196
UniProt: P69912
LinkDB All DBs
Position
1807985..1809385
Genome map
AA seq 466 aa AA seqDB search
MDKKQVTDLRSELLDSRFGAKSISTIAESKRFPLHEMRDDVAFQIINDELYLDGNARQNL
ATFCQTWDDENVHKLMDLSINKNWIDKEEYPQSAAIDLRCVNMVADLWHAPAPKNGQAVG
TNTIGSSEACMLGGMAMKWRWRKRMEAAGKPTDKPNLVCGPVQICWHKFARYWDVELREI
PMRPGQLFMDPKRMIEACDENTIGVVPTFGVTYTGNYEFPQPLHDALDKFQADTGIDIDM
HIDAASGGFLAPFVAPDIVWDFRLPRVKSISASGHKFGLAPLGCGWVIWRDEEALPQELV
FNVDYLGGQIGTFAINFSRPAGQVIAQYYEFLRLGREGYTKVQNASYQVAAYLADEIAKL
GPYEFICTGRPDEGIPAVCFKLKDGEDPGYTLYDLSERLRLRGWQVPAFTLGGEATDIVV
MRIMCRRGFEMDFAELLLEDYKASLKYLSDHPKLQGIAQQNSFKHT
NT seq 1401 nt NT seq  +upstreamnt  +downstreamnt
atggataagaagcaagtaacggatttaaggtcggaactactcgattcacgttttggtgcg
aagtctatttccactatcgcagaatcaaaacgttttccgctgcacgaaatgcgcgacgat
gtcgcatttcagattatcaatgatgaattatatcttgatggcaacgctcgtcagaacctg
gccactttctgccagacctgggacgacgaaaacgtccacaagttgatggatttatccatt
aacaaaaactggatcgacaaagaagaatatccgcaatccgcagccatcgacctgcgttgc
gtaaacatggttgccgatctgtggcatgcgcctgcgccgaaaaatggtcaggccgttggc
accaacaccattggttcttccgaggcctgtatgctcggcgggatggcgatgaaatggcgt
tggcgcaagcgtatggaagctgcaggcaaaccaacggataaaccaaacctggtgtgcggt
ccggtgcaaatctgctggcataaattcgcccgctactgggatgtggagctgcgtgagatc
cctatgcgccccggtcagttgtttatggacccgaaacgcatgattgaagcctgcgacgaa
aataccatcggcgtggtgccgactttcggcgtgacctacaccggtaactatgagttcccg
caaccgctgcacgatgcactggataaattccaggccgacaccggtatcgacatcgacatg
cacatcgacgccgccagcggtggctttctggcaccgttcgtcgccccggatatcgtctgg
gacttccgcctgccgcgtgtgaaatcgatcagtgcttcaggccataaattcggtctggct
ccgctgggctgcggctgggttatctggcgtgacgaagaagcgctgccgcaggaactggtg
ttcaacgttgactacctcggtggtcagattggtacttttgccatcaacttctcccgcccg
gcgggtcaggtgattgcacagtactatgaattcctgcgccttggtcgtgaaggctatacc
aaagtacagaatgcttcctaccaggtcgctgcctatctggcggatgagatcgccaaactg
gggccgtatgagttcatctgtaccggtcgcccggacgaaggcatcccggcggtttgcttc
aaactgaaagatggtgaagatccgggatacaccctgtacgacctctctgaacgtctgcgt
ctgcgcggctggcaggttccggccttcactctcggcggtgaagccaccgacatcgtggtg
atgcgcattatgtgtcgtcgcggcttcgaaatggactttgctgaactgttgctggaagac
tacaaagcctccctgaaatatctcagcgatcacccgaaactgcagggtattgcccagcag
aacagctttaaacatacctga

DBGET integrated database retrieval system