KEGG   Shigella flexneri 2457T (serotype 2a): S3003
Entry
S3003             CDS       T00128                                 

Gene name
ygdH
Definition
(GenBank) hypothetical protein
  KO
K06966  pyrimidine/purine-5'-nucleotide nucleosidase [EC:3.2.2.10 3.2.2.-]
Organism
sfx  Shigella flexneri 2457T (serotype 2a)
Pathway
sfx00230  Purine metabolism
sfx00240  Pyrimidine metabolism
sfx01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sfx00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    S3003 (ygdH)
   00240 Pyrimidine metabolism
    S3003 (ygdH)
Enzymes [BR:sfx01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.2  Hydrolysing N-glycosyl compounds
    3.2.2.10  pyrimidine-5'-nucleotide nucleosidase
     S3003 (ygdH)
    3.2.2.-  
     S3003 (ygdH)
SSDB
Motif
Pfam: DUF3412 DUF4478 Lysine_decarbox LDcluster4
Other DBs
NCBI-ProteinID: AAP18121
UniProt: P0ADS1
LinkDB
Position
2879997..2881361
AA seq 454 aa
MITHISPLGSMDMLSQLEVDMLKRTASSDLYQLFRNCSLAVLNSGSLTDNSKELLSRFEN
FDINVLRRERGVKLELINPPEEAFVDGRIIRALQANLFAVLRDILFVYGQIHNTVRFPNL
NLDNSVHITNLVFSILRNARALHVGEAPNMVVCWGGHSINENEYLYARRVGNQLGLRELN
ICTGCGPGAMEAPMKGAAVGHAQQRYKDSRFIGMTEPSIIAAEPPNPLVNELIIMPDIEK
RLEAFVRIAHGIIIFPGGVGTAEELLYLLGILMNPANKDQVLPLILTGPKESADYFRVLD
EFVVHTLGENARRHYRIIIDDAAEVARQMKKSMPLVKENRRDTGDAYSFNWSMRIAPDLQ
MPFEPSHENMANLKLYPDQPVEVLAADLRRAFSGIVAGNVKEVGIRAIEEFGPYKINGDK
EIMRRMDDLLQGFVAQHRMKLPGSAYIPCYEICT
NT seq 1365 nt   +upstreamnt  +downstreamnt
ttgattacacatattagcccgcttggctccatggatatgttgtcgcagctggaagtggat
atgcttaaacgcaccgccagcagcgacctctatcaactgtttcgcaactgttcacttgcc
gtactgaactccggtagtttgaccgataacagcaaagaattgctgtctcgttttgaaaat
ttcgatattaacgtcctgcgccgtgaacgcggcgtaaagctggaactgattaatcccccg
gaagaggcttttgtcgatgggcgaattattcgcgctttgcaggccaacttgttcgcggtt
ctgcgagacattctcttcgtttacgggcaaatccataataccgttcgttttcccaacctg
aatctcgacaactccgtccacatcactaacctggtcttttccatcttgcgtaacgctcgc
gcgctgcatgtgggtgaagcgccaaatatggtggtctgctggggcggtcactcaattaac
gaaaacgagtatttgtatgcccgtcgcgtcgggaaccagctgggcctgcgtgagctgaat
atctgcaccggctgtggtccaggagcgatggaagcgccgatgaaaggtgctgcggtcgga
cacgcgcagcagcgttacaaagacagtcgttttattggtatgacagagccgtcgattatc
gccgctgaaccgcctaacccactggtcaacgaattgatcatcatgccggatatcgaaaaa
cgtctggaagcgtttgtccgtatcgctcacggcatcattatcttccctggcggtgtgggt
acggcagaagagttgctgtatttgctgggaattttaatgaacccggccaacaaagatcag
gttttaccattgatcctcaccggcccgaaagagagcgccgactacttccgcgtactggac
gagtttgtcgtacatacgctgggcgaaaacgcgcgccgccattaccgcatcatcattgat
gacgccgctgaagtcgctcgtcagatgaaaaaatcgatgccgctggtgaaagaaaatcgc
cgtgatacaggcgatgcctacagctttaactggtcaatgcgcattgcgccagatttgcaa
atgccgtttgagccgtctcacgagaatatggctaatctgaagctttacccggatcaacct
gttgaagtgctggctgccgacctgcgccgtgcgttctccggtattgtggcgggtaacgta
aaagaagtcggtattcgcgccattgaagagtttggtccttacaaaatcaacggcgataaa
gagattatgcgtcgtatggacgacctgctacagggttttgttgcccagcatcgtatgaag
ttgccaggctcagcctacatcccttgctacgaaatctgcacgtaa

DBGET integrated database retrieval system