KEGG   Shigella flexneri 2457T (serotype 2a): S3830Help
Entry
S3830             CDS       T00128                                 

Gene name
fadB
Definition
(GenBank) 4-enzyme protein, 3-hydroxyacyl-CoA dehydrogenase; 3-hydroxybutyryl-CoA epimerase; delta(3)-cis-delta(2)-trans-enoyl-CoA isomerase; enoyl-CoA hydratase
  KO
K01825  3-hydroxyacyl-CoA dehydrogenase / enoyl-CoA hydratase / 3-hydroxybutyryl-CoA epimerase / enoyl-CoA isomerase [EC:1.1.1.35 4.2.1.17 5.1.2.3 5.3.3.8]
Organism
sfx  Shigella flexneri 2457T (serotype 2a)
Pathway
sfx00071  Fatty acid degradation
sfx00280  Valine, leucine and isoleucine degradation
sfx00281  Geraniol degradation
sfx00310  Lysine degradation
sfx00362  Benzoate degradation
sfx00380  Tryptophan metabolism
sfx00410  beta-Alanine metabolism
sfx00640  Propanoate metabolism
sfx00650  Butanoate metabolism
sfx00903  Limonene and pinene degradation
sfx00930  Caprolactam degradation
sfx01100  Metabolic pathways
sfx01110  Biosynthesis of secondary metabolites
sfx01120  Microbial metabolism in diverse environments
sfx01130  Biosynthesis of antibiotics
sfx01200  Carbon metabolism
sfx01212  Fatty acid metabolism
Module
sfx_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:sfx00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    S3830 (fadB)
   00650 Butanoate metabolism
    S3830 (fadB)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    S3830 (fadB)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    S3830 (fadB)
   00310 Lysine degradation
    S3830 (fadB)
   00380 Tryptophan metabolism
    S3830 (fadB)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    S3830 (fadB)
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    S3830 (fadB)
   00281 Geraniol degradation
    S3830 (fadB)
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    S3830 (fadB)
   00930 Caprolactam degradation
    S3830 (fadB)
Enzymes [BR:sfx01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     S3830 (fadB)
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     S3830 (fadB)
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.2  Acting on hydroxy acids and derivatives
    5.1.2.3  3-hydroxybutyryl-CoA epimerase
     S3830 (fadB)
  5.3  Intramolecular oxidoreductases
   5.3.3  Transposing C=C bonds
    5.3.3.8  Delta3-Delta2-enoyl-CoA isomerase
     S3830 (fadB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 3HCDH_N ECH_1 3HCDH ECH_2
Motif
Other DBs
NCBI-ProteinID: AAP18841
UniProt: Q83PG1
LinkDB All DBs
Position
3729390..3731579
Genome map
AA seq 729 aa AA seqDB search
MLYKGDTLYLDWLEDGIAELVFDAPGSVNKLDTATVASLGEAIGVLEQQSDLKGLLLRSN
KAAFIVGADITEFLSLFLVPEEQLSQWLHFANSVFNRLEDLPVPTIAAVNGYALGGGCEC
VLATDYRLATPDLRIGLPETKLGIMPGFGGSVRMPRMLGADSALEIIAAGKDVGADQALK
IGLVDGVVKAEKLIEGAMAILRQAINGDLDWKAKRQPKQEPLKLSKIEATMSFTIAKGMV
AQTAGKHYPAPITAVKTIEAAARFGREEALNLENKSFVPLAHTNEARALVGIFLNDQYVK
GKAKKLTKDVETPKQAAVLGAGIMGGGIAYQSAWKGVPVVMKDINDKSLTLGMTEAAKLL
NKQLERGKIDGLKLAGVISTIHPTLDYAGFDRVDIVVEAVVENPKVKKAVLAETEQKVRQ
DTVLASNTSTIPISELANALERPENFCGMHFFNPVHRMPLVEIIRGEKSSDETIAKVVAW
ASKMGKTPIVVNDCPGFFVNRVLFPYFAGFSQLLRDGADFRKIDKVMEKQFGWPMGPAYL
LDVVGIDTAHHAQAVMAAGFPQRMQKDYRDAIDALFDANRFGQKNGLGFWRYKEDSKGKP
KKEEDAAVEDLLAEVSQPKRDFSEEEIIARMMIPMVNEVVRCLEEGIIATPAEADMALVY
GLGFPPFHGGAFRWLDTLGSAKYLDMAQQYQHLGPLYEVPEGLRNKARHNEPYYPPVEPA
RPVGDLKTA
NT seq 2190 nt NT seq  +upstreamnt  +downstreamnt
atgctttacaaaggcgacaccctgtaccttgactggctggaagatggcattgccgaactg
gtatttgatgccccaggttcagttaataaactcgacactgcgaccgtcgccagcctcggc
gaggccatcggcgtgctggaacagcaatcagatctaaaagggctgctgctgcgttcgaac
aaagcagcctttatcgtcggtgctgatatcaccgaatttttgtccctgttcctcgttcct
gaagaacagttaagtcagtggctgcactttgccaatagcgtgtttaatcgcctggaagat
ctgccggtgccgaccattgctgccgtcaacggctatgcgctgggtggtggctgcgaatgc
gtgctggcgaccgattatcgtctggcgacgccggatctgcgcatcggtctgccggaaacc
aaactgggcatcatgccgggctttggcggttctgtacgtatgccacgtatgctgggcgct
gacagtgcactggaaatcattgccgccggtaaagatgtcggcgcggatcaggcgctgaaa
atcggtctggtggatggcgtagtcaaagcagaaaaactgattgaaggggcgatggcgatt
ttacgccaggccattaacggcgacctcgactggaaagcgaaacgtcagccgaagcaggaa
ccgctaaaactgagcaagattgaagccaccatgagcttcaccatcgctaaaggaatggtc
gcgcaaacggcggggaaacattatccggcccccatcaccgcagtaaaaaccattgaagct
gcggcccgttttggtcgtgaagaagccttaaatctggaaaacaaaagttttgtcccgctg
gcgcataccaacgaagctcgcgcactggtcggcattttccttaacgatcaatatgtaaaa
ggcaaagcgaagaaactcaccaaagacgttgaaaccccgaaacaggctgctgtgctgggc
gcaggcatcatgggtggcggtatcgcttaccagtccgcgtggaaaggcgtgccggttgtc
atgaaagatatcaacgacaagtcgttaaccctcggcatgaccgaagccgcgaaactgctg
aacaagcagcttgagcgcggcaaaatcgatggtctgaaactggctggcgtgatctccacg
atccacccaacgctcgactacgccggatttgaccgcgtggatattgtggtagaagcggtt
gttgaaaacccgaaagtgaaaaaagccgtactggcagaaaccgaacaaaaagtacgccag
gataccgtgctggcgtctaacacttcaaccattcctatcagcgaactggccaacgcgctg
gaacgcccggaaaacttctgcgggatgcacttctttaacccggtccaccgaatgccgttg
gtagaaattattcgcggcgagaaaagctccgacgaaaccatcgcgaaagttgtcgcctgg
gcgagcaagatgggcaagacgccgattgtggttaacgactgccccggcttctttgttaac
cgcgtgctgttcccgtatttcgccggtttcagccagctgctgcgcgacggcgcggatttc
cgcaagatcgacaaagtgatggaaaaacagtttggctggccgatgggcccggcatatctg
ctggacgttgtgggcattgataccgcgcatcacgctcaggctgtcatggcagcaggcttc
ccgcagcggatgcagaaagattaccgcgatgccatcgacgcgctgtttgatgccaaccgc
tttggtcagaagaacggcctcggtttctggcgttataaagaagacagcaaaggtaagccg
aagaaagaagaagacgccgccgttgaagacctgctggcagaagtgagccaaccgaagcgc
gatttcagcgaagaagagattatcgcccgcatgatgatcccgatggtcaacgaagtggtg
cgctgtctggaagagggcattatcgccactccggcggaagcggatatggcgctggtctac
ggcctgggcttccctccgttccacggcggcgcgttccgctggctggacaccctcggtagc
gcaaaatacctcgatatggcacagcaatatcagcacctcggcccgctgtatgaagtgccg
gaaggtctgcgtaataaagcgcgtcataacgaaccgtactatcctccggttgagccagcc
cgtccggttggcgacctgaaaacggcttaa

DBGET integrated database retrieval system