KEGG   Shigella flexneri 2457T (serotype 2a): S4316Help
Entry
S4316             CDS       T00128                                 

Gene name
glpD
Definition
(GenBank) sn-glycerol-3-phosphate dehydrogenase (aerobic)
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
sfx  Shigella flexneri 2457T (serotype 2a)
Pathway
sfx00564  Glycerophospholipid metabolism
sfx01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:sfx00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    S4316 (glpD)
Enzymes [BR:sfx01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     S4316 (glpD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO DAO_C
Motif
Other DBs
NCBI-ProteinID: AAP19273
UniProt: A0A0H2VZJ4
LinkDB All DBs
Position
complement(4237934..4239412)
Genome map
AA seq 492 aa AA seqDB search
MAASMVLVSRADAAGRGLSVLMLEAQDLACATSSASSKLIHGGLRYLEHYEFRLVSEALA
EREVLLKMAPHIAFPMRFRLPHRPHLRPAWMIRIGLFMYDHLGKRTSLPGSTGLRFGANS
VLKPEIKRGFEYSDCWVDDARLVLANAQMVVRKGGEVLTRTRATSARRENGLWIVEAEDI
DTGKKYSWQARGLVNATGPWVKQFFDEGMHLPSPYGIRLIKGSHIVVPRVHTQKQAYILQ
NEDKRIVFVIPWMDEFSIIGTTDVEYKGDPKAVKIEESEINYLLKVYNAHFKKQLSRDDI
VWTYSGVRPLCDDESDSPQAITRDYTLDIHDENGKAPLLSVFGGKLTTYRKLAEHALEKL
TPYYQGIGPAWTKESVLPGGAIEGDRDDYAARLRRRYPFLTESLARHYTRTYGSNSELLL
GNAGTVSDLGEDFGHEFYEAELKYLVDHEWVRRTDDALWRRTKQGMWLNADQQSRVSQWL
VEYTQQKLSLAS
NT seq 1479 nt NT seq  +upstreamnt  +downstreamnt
gtggcggcatcaatggtgctggtatcgcgggcagacgccgctggacgcggtttatccgtg
ctgatgctggaggcgcaggatctcgcttgcgcgacctcttccgccagttcaaaactcatt
cacggtggcctgcgctaccttgagcactatgaattccgcctggtcagcgaggcgctggct
gaacgtgaagtgctgctgaaaatggctccgcatatcgccttcccgatgcgttttcgcctg
ccacatcgtccgcatctgcgcccggcgtggatgattcgcattggtctgtttatgtacgat
catctgggtaaacgcaccagcctgccgggatcaactggtttgcgttttggcgcaaattca
gtgttaaaaccggaaattaagcgcggattcgaatattctgactgttgggtagacgacgcc
cgtctggtactcgccaacgcccagatggtggtgcgtaaaggcggcgaagtgcttactcgg
actcgcgccacctctgctcgccgcgaaaacggcctgtggattgtggaagcggaagatatc
gataccggcaaaaaatatagctggcaagcgcgcggcctggttaacgccaccggcccgtgg
gtgaaacagttcttcgacgaggggatgcatctgccttcgccttatggcattcgcctgatc
aaaggcagccatattgtggtgccgcgcgtgcatacccaaaagcaggcctacattctgcaa
aacgaagataaacgcattgtgttcgtgatcccgtggatggacgagttttccatcatcggc
accaccgatgtggaatacaaaggtgatccgaaagcagtgaagattgaagagagtgaaatc
aattacctgctgaaagtgtataacgcgcactttaaaaagcagctaagccgtgacgatatc
gtctggacctactccggtgtgcgtccgctgtgtgatgatgagtccgactcgccgcaagcc
attacccgtgattacacccttgatatccatgatgaaaacggcaaagcaccgctgctgtcg
gtattcggcggtaagctgaccacctaccgaaaactggcagaacatgcgctggaaaaactg
acgccgtattatcagggtattggcccggcgtggacgaaagagagcgtgctgccgggtggt
gccattgaaggcgaccgcgacgattacgccgctcgcctgcgccgccgttacccgttcctg
actgaatcgctggcacgtcactacacgcgcacttacggcagcaacagcgagctgctgctc
ggcaatgcgggaacggtaagcgatctcggggaagatttcggtcatgagttctacgaagcg
gaactgaaatacctggtggatcacgaatgggtccgccgcaccgacgatgccctgtggcgt
cgcacaaaacaaggcatgtggctgaatgcggatcaacaatctcgtgtgagtcagtggctg
gtggaatatacgcagcagaagttgtcgctggcgtcgtaa

DBGET integrated database retrieval system