KEGG   Streptococcus gallolyticus UCN34: GALLO_0662Help
Entry
GALLO_0662        CDS       T01171                                 

Gene name
sodA
Definition
(GenBank) superoxide dismutase
  KO
K04564  superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
sga  Streptococcus gallolyticus UCN34
Brite
Enzymes [BR:sga01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     GALLO_0662 (sodA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Fe_C Sod_Fe_N Alliinase_C
Motif
Other DBs
NCBI-ProteinID: CBI13154
LinkDB All DBs
Position
687792..688400
Genome map
AA seq 202 aa AA seqDB search
MAIILPKLPYAYDALEPYIDTETMTIHHDKHHATYVANVNAALEKHPEIGEALEALLADV
DNIPADIRQAVINNGGGHLNHALFWELLSPEKQEPTAQVLAAIEEAFGSFDEFKAAFTQA
ATTRFGSGWAWLVVNENGKLEVLSTANQDTPISQGKAPILALDVWEHAYYLKYRNVRPDY
IKAFFDVINWEKVAELYSKATK
NT seq 609 nt NT seq  +upstreamnt  +downstreamnt
atggctattattttaccaaaactaccttatgcatatgatgctcttgagccttatattgat
acagaaacaatgacaattcatcatgataaacatcacgctacttatgtggcaaatgtaaat
gcagcgcttgaaaaacatccagaaattggagaggctttggaagctttgttggcagatgtt
gacaatattccagcagatatccgtcaagcggtgattaataacggtggtgggcatttgaat
cacgcccttttctgggaattgttatcgcctgaaaaacaagaaccaacagcgcaagtgttg
gctgcgattgaggaagcttttggctcatttgacgaattcaaagctgctttcacgcaagct
gcgacaactcgttttgggtcaggttgggcttggcttgtggtgaatgaaaatggcaaactt
gaagtgctctcgacagctaatcaagacacaccaatttcacagggaaaagcaccaattttg
gcacttgacgtttgggaacacgcttactatctcaagtatcgcaacgttcgcccagattac
atcaaagctttctttgatgttattaattgggaaaaagttgctgagctttactcaaaagca
acaaagtga

DBGET integrated database retrieval system