KEGG   Streptococcus gallolyticus UCN34: GALLO_0869Help
Entry
GALLO_0869        CDS       T01171                                 

Definition
(GenBank) putative pyruvate/2-oxoglutarate dehydrogenase, dihydrolipoamide acetyltransferase E2 subunit
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
sga  Streptococcus gallolyticus UCN34
Pathway
sga00010  Glycolysis / Gluconeogenesis
sga00020  Citrate cycle (TCA cycle)
sga00620  Pyruvate metabolism
sga01100  Metabolic pathways
sga01110  Biosynthesis of secondary metabolites
sga01120  Microbial metabolism in diverse environments
sga01130  Biosynthesis of antibiotics
sga01200  Carbon metabolism
Module
sga_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:sga00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    GALLO_0869
   00020 Citrate cycle (TCA cycle)
    GALLO_0869
   00620 Pyruvate metabolism
    GALLO_0869
Enzymes [BR:sga01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     GALLO_0869
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh E3_binding Biotin_lipoyl Biotin_lipoyl_2
Motif
Other DBs
NCBI-ProteinID: CBI13361
LinkDB All DBs
Position
918770..920164
Genome map
AA seq 464 aa AA seqDB search
MANEIIMPKLGVDMQEGEILEWKKAEGDEVNEGDILLEIMSDKTNMEIEAEDSGVLLKIV
HPAGDVVAVTEIIGYIGAEGETLVDSVGEKHVEQSASAQEAKAQPLQASTAPAISQKTSE
TGKVRATPAARKLARERGIDLEKITGSGENGRIHKEDVEQFSKIRVTPLARRIAKDKGVD
LETLVGTGVSGKITKEDVLASLGDVAPQKEQADVKVTPQAGALADVTAASDGVEVIKMSA
MRKAISKGMSHSYFTAPTFTLNYDIDMTNLIALRKQLIEPIMAKTGYKVTFTDLIGLAVI
KTLMKEEHRFLNASLINDAQDIELHHFVNLAIAVGLSEGLVVPVVHGADQMSLSDFVVAS
KDVIQKAQAGKLKAAEMSGSTFTITNLGMFGVKSFNPIINQPNSAILGISATIETPVVHD
GEVVIRPIMGMSLTIDHRLVDGMNGAKFMLDLKALLENPLELLI
NT seq 1395 nt NT seq  +upstreamnt  +downstreamnt
gtggcaaatgaaattattatgccaaagcttggtgtggacatgcaagaaggggaaattctt
gaatggaaaaaagctgaaggtgatgaggtcaatgagggtgatattctgcttgaaatcatg
tctgataagaccaatatggaaatcgaagctgaagattctggcgtgctgttgaaaatcgtt
catccggcaggtgatgtcgtagctgttaccgaaattatcggctatatcggagcagaaggt
gaaactcttgttgattctgtgggtgagaaacatgttgaacagtcagcatcagctcaggaa
gcgaaagctcaaccgttgcaagcaagcacagcgccagcgatttcccaaaagacgtctgaa
actggaaaagtccgtgctacgcctgctgctagaaagttagcacgtgagcgtggtattgac
cttgaaaaaatcactggcagcggtgaaaatgggcggattcacaaggaagatgtggaacaa
tttagtaagattcgtgtgacgccactggctcgtaggattgcaaaggacaaaggtgttgac
cttgagacactggtgggaacgggtgtttctggtaagattaccaaggaagatgttttagca
agtctaggtgatgttgcgccgcaaaaagaacaagcagatgtaaaagtgacaccgcaagca
ggagctttggctgatgttacggctgcaagtgacggcgttgaagtcattaagatgtctgct
atgcgtaaggcaatttcaaagggaatgagccattcttactttacagcaccgacctttacg
cttaattatgatattgatatgacgaatctgattgccttgcgtaagcaactcattgagcca
attatggcaaagactggttacaaggtgacctttacggacttaattgggcttgctgtgatt
aagaccttgatgaaggaggaacaccgtttccttaatgcttctctgattaacgacgctcaa
gacatcgaactacatcattttgtcaatcttgcaatcgctgttgggctttctgaaggttta
gtggttcctgtggttcatggtgcagaccagatgagtttgtcagactttgtggtagcatca
aaagatgtgattcaaaaagcacaagctggtaaattgaaagcggctgaaatgtctggctca
acattcaccataacgaaccttgggatgtttggagtgaagtcgtttaatccgattattaat
caaccaaattcggcaattcttgggatttcagcaactattgaaacacccgtcgttcatgac
ggtgaagtggttattcgcccaattatggggatgagtttgaccattgatcaccgattggtt
gacggaatgaatggtgcaaaattcatgctagatttaaaagcgcttcttgaaaatccgcta
gaattgctaatctaa

DBGET integrated database retrieval system