KEGG   Streptococcus gallolyticus UCN34: GALLO_1000Help
Entry
GALLO_1000        CDS       T01171                                 

Definition
(GenBank) Putative amino acid ABC transporter, substrate binding protein
  KO
K02030  polar amino acid transport system substrate-binding protein
Organism
sga  Streptococcus gallolyticus UCN34
Brite
KEGG Orthology (KO) [BR:sga00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:sga02000]
    GALLO_1000
Transporters [BR:sga02000]
 ABC Transporters, Prokaryotic Type
  Phosphate and amino acid transporters
   Putative polar amino acid transporter
    GALLO_1000
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SBP_bac_3 Lig_chan-Glu_bd NMT1 Phosphonate-bd
Motif
Other DBs
NCBI-ProteinID: CBI13492
LinkDB All DBs
Position
1055826..1056668
Genome map
AA seq 280 aa AA seqDB search
MKFKKVLMGALALVSTLTLAACSSSSSKKATSTDQWDTYVKNGEITIGFDNTFVPMGYED
EDGSNVGFDIDLANAVFKEYGITVKWQSINWDMKETELNNGTIDLIWNGYSITDERAEKV
LFTNPYMVNEQVLVTKKSSGITSFADMKDKVLGAQSGSSGYDAFTSNPEVLKDIVSGGDA
TQYETFTQALIDLKNDRIDGLLIDKVYANYYLEQEGELDNYNIISSEFDGEDFAVGARKA
DKTLVKKINQAFKKLYQDGTFQEISNKWFGEDVATDDVKN
NT seq 843 nt NT seq  +upstreamnt  +downstreamnt
atgaaattcaaaaaagttcttatgggcgctttggcgcttgtatcaacactaactttggca
gcttgtagttcttcatcatctaaaaaagctactagcactgaccaatgggacacttatgtt
aaaaacggtgaaattactatcggttttgataatacattcgttcccatggggtacgaggat
gaggatggaagcaatgtcggttttgatattgatttggcaaatgccgtctttaaagaatat
ggtattaccgtcaaatggcaatcaattaactgggatatgaaagaaaccgagttgaataac
ggaaccattgatttgatttggaacggttattcaatcacagatgagcgtgcagaaaaagtc
ctcttcacaaacccatacatggttaacgagcaagtcttggtaactaaaaaatcatcaggt
attacaagctttgctgacatgaaagataaagtgcttggtgcacagtcagggtcatctggt
tacgatgcgttcacatcaaatccagaagtgttgaaggacattgtttctggtggcgatgcg
acacaatacgaaaccttcacacaagcacttatcgatttgaaaaatgaccgtattgacggt
ttgttgattgataaagtttatgctaattactaccttgaacaagaaggcgaacttgataac
tacaatatcatttcaagtgaatttgacggtgaagactttgccgttggtgctcgtaaagcc
gataaaacacttgttaagaaaatcaatcaagcttttaagaaattgtatcaagatggtaca
ttccaagaaatttcaaacaaatggtttggtgaagatgtcgcaacagacgacgttaaaaac
taa

DBGET integrated database retrieval system