KEGG   Streptococcus gallolyticus UCN34: GALLO_1886Help
Entry
GALLO_1886        CDS       T01171                                 

Gene name
alr
Definition
(GenBank) Putative alanine racemase
  KO
K01775  alanine racemase [EC:5.1.1.1]
Organism
sga  Streptococcus gallolyticus UCN34
Pathway
sga00473  D-Alanine metabolism
sga01100  Metabolic pathways
sga01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:sga00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    GALLO_1886 (alr)
 09160 Human Diseases
  09168 Drug resistance
   01502 Vancomycin resistance
    GALLO_1886 (alr)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:sga01011]
    GALLO_1886 (alr)
Enzymes [BR:sga01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.1  alanine racemase
     GALLO_1886 (alr)
Peptidoglycan biosynthesis and degradation proteins [BR:sga01011]
 Precursor biosynthesis
  Racemase
   GALLO_1886 (alr)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ala_racemase_N Ala_racemase_C Pox_EPC_I2-L1
Motif
Other DBs
NCBI-ProteinID: CBI14377
LinkDB All DBs
Position
complement(1958534..1959640)
Genome map
AA seq 368 aa AA seqDB search
MISSLHRPTKAVIDLDAICQNIDAVKANIPQDKKAFAVVKANAYGHGATSVAQAIHHLVD
GFCVSNIDEALELREAGIEETILILGVIMPDEVALARDYHVTLTVASQEWLDLANEQGIS
LAGLDVHLKVDSGMGRIGVRSLDEAENVIANLKKAGANVAGIFTHFATADEADDTKFNEQ
LEFFTNLVNNLSDKPAIVHASNSATSIWHSETIFNLVRLGIVMYGLNPSGTELDLPYPLK
PALSLESSLVHVKTIPAGATVGYGATYTAQKEEYIATVPIGYADGWTRDLQGFSVLVNGE
FCEIVGRVSMDQITIRLPEKLPIGTKVTLIGQEGSKVISATDLAQKRGTINYEVLCLLSD
RIPRVYSK
NT seq 1107 nt NT seq  +upstreamnt  +downstreamnt
atgatttcaagtttacacagaccaacaaaggcagtcattgatttagatgccatttgtcaa
aatattgatgcggttaaagccaatataccacaagataaaaaagcttttgcagttgttaaa
gctaatgcttatggacacggtgccacaagcgtagcgcaagctattcatcatcttgtggat
ggattctgtgtgtcaaatattgatgaagctttggaattacgtgaagcaggtattgaggaa
acaatccttattttaggtgttattatgcctgatgaggtggctttggcgcgtgattaccat
gttactttgacagttgctagtcaagaatggcttgatttggcaaatgaacaaggtattagc
ttagctggtttggacgttcacttgaaagtggattctggtatggggcgaatcggtgtgcgc
agtcttgatgaagcagaaaatgtgattgcgaatttgaaaaaagctggggctaacgttgca
ggtatctttacgcattttgcaacagcagacgaagctgacgatacgaaattcaatgaacag
ttggaattctttacgaatttggttaacaatttgagcgacaagcctgccattgtccatgct
agtaattcagcaacaagtatttggcatagtgaaaccatttttaaccttgttcgacttggg
attgtcatgtatggattgaatccaagtggaacagagcttgatttaccttatccgcttaaa
ccagcgcttagtttggaatcatcattggttcatgttaagacgattcctgctggtgcaacg
gttggctacggtgcgacctatactgctcaaaaagaggaatatatcgcgactgttccaatc
ggttacgcagacggttggacacgtgatttacaaggtttctcagtgcttgtgaatggcgaa
ttttgtgaaatcgttggacgcgtgtcaatggatcaaattaccattcgcttgccagaaaaa
cttccaatcggaacgaaagttactttgattggtcaagagggcagtaaggttatttcagcg
acagatttggctcaaaaacgtggcacaatcaattacgaagttctttgtctattgagtgac
cgtattccacgtgtttattcaaaataa

DBGET integrated database retrieval system