KEGG   Streptococcus gallolyticus UCN34: GALLO_1917Help
Entry
GALLO_1917        CDS       T01171                                 

Definition
(GenBank) putative NADH oxidase/alkyl hydroperoxidase
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
sga  Streptococcus gallolyticus UCN34
Brite
KEGG Orthology (KO) [BR:sga00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    GALLO_1917
Enzymes [BR:sga01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     GALLO_1917
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox Thioredoxin_3 GIDA FAD_oxidored FAD_binding_2 AlaDh_PNT_C HI0933_like Thi4 FAD_binding_3 Lycopene_cycl Glutaredoxin NAD_binding_8 FMO-like NAD_Gly3P_dh_N DAO K_oxygenase
Motif
Other DBs
NCBI-ProteinID: CBI14408
LinkDB All DBs
Position
complement(1988173..1989711)
Genome map
AA seq 512 aa AA seqDB search
MALDAEIKTQLSQYLALIESDIVFQANLGTDENSKKVRDFIDEIVSMSDKIGFEEKKLSR
TPAFRIAKKGQESGVEFAGLPLGHELTSLILALLQVSGRPPKVDEEVINRIKAIDTPLHF
ETYVSLSCHNCPDVVQAFNIMAVINPNISHTMIEGGMFQDEVKAKGIMSVPTVFHNDEIL
TSGRINIEQLLDLIAGPVSETTFADKGIFDVLVIGGGPAGNSAAIYAARKGIKTGLLAET
FGGQVMETVGIENMIGTPYIEGPALMSQVEEHTKSYDVDIMKAQKAIAIHKKDVIEVTLA
NGAILKSKTAILSLGAKWRNINVPGEVEFRNKGVTYCPHCDGPLFTDKKVAVIGGGNSGL
EAAIDLAGLASHVYILEFLPELKADKVLQDRAEAHDNITILKNVATKEILGDEQVTGLIY
TDRETDVDKTLDLEGVFVQIGLVPNTDWLKDSGIDLNNRGEIIVDNQGSTTVAGIFAAGD
CTDQAYKQIIISMGSGATAALGVFDYLIRMND
NT seq 1539 nt NT seq  +upstreamnt  +downstreamnt
atggcattagatgcagaaatcaaaacacaattgtcgcaatatcttgcattaattgaatct
gatattgtttttcaggctaatcttggaacagatgaaaattctaaaaaagtcagagatttc
attgatgaaatcgtctcaatgagtgataagattggttttgaagagaagaagcttagtcgt
acgcctgcttttcgaattgctaaaaaaggacaagaatctggtgttgaatttgccggctta
ccactgggacatgagttgacttcattgattctggcacttttacaggtttctggacgacca
ccaaaagtagatgaggaagtcatcaaccgaattaaagctattgatacccctcttcatttt
gaaacttatgtcagtcttagttgtcataattgtccggatgttgtacaagctttcaatatt
atggctgtgattaatccgaatattagccataccatgattgagggaggtatgttccaagat
gaggtcaaggctaaggggattatgtccgttccaaccgtttttcacaatgatgaaatactg
acttcaggacgtatcaacattgaacaattacttgatttgattgcaggaccagtgtcagaa
acgacatttgcagataagggaatttttgatgtcttggttattggtggcggaccggctgga
aatagcgcagctatttatgctgcacgaaaaggaatcaaaacaggcttattagccgaaacg
tttggtggacaagtgatggaaaccgtcggaattgaaaatatgattggaacaccttatata
gagggaccagcgcttatgtcccaagtagaagagcacaccaaatcatacgatgtcgatatc
atgaaagctcaaaaagcgatagctattcataaaaaggatgttatcgaagttacgctagct
aacggtgctattctaaagtctaaaacagccattctatctcttggtgccaaatggcgtaat
attaatgttccgggagaagttgaatttagaaataaaggagtcacttactgtcctcactgt
gatggaccactctttacagataaaaaagtagctgtcattggtggtggtaattcagggctt
gaagctgccattgatttagcaggacttgctagccatgtctatattcttgaatttttacca
gaattaaaagctgataaagtcttacaagatcgtgcagaagcacatgataatattactatt
ttgaaaaatgttgccacaaaagaaattttgggtgatgagcaggttacgggactaatttat
acggatagagaaactgacgtggacaaaacacttgatttagagggagtctttgttcaaatt
ggtctcgttccaaataccgactggctaaaagattctggcattgaccttaataatcgtggt
gaaattattgtggataatcaagggagtacaactgttgcaggtatttttgcagctggcgac
tgtacggatcaagcatacaagcaaattattatttctatgggaagcggagccactgcagcc
ttaggtgtatttgactaccttatcagaatgaatgattaa

DBGET integrated database retrieval system