KEGG   Streptomyces globisporus: WQO_07600Help
Entry
WQO_07600         CDS       T04209                                 

Definition
(GenBank) aminotransferase
  KO
K14260  alanine-synthesizing transaminase [EC:2.6.1.66 2.6.1.2]
Organism
sgb  Streptomyces globisporus
Pathway
sgb00220  Arginine biosynthesis
sgb00250  Alanine, aspartate and glutamate metabolism
sgb00290  Valine, leucine and isoleucine biosynthesis
sgb01100  Metabolic pathways
sgb01110  Biosynthesis of secondary metabolites
sgb01130  Biosynthesis of antibiotics
sgb01210  2-Oxocarboxylic acid metabolism
sgb01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:sgb00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    WQO_07600
   00290 Valine, leucine and isoleucine biosynthesis
    WQO_07600
   00220 Arginine biosynthesis
    WQO_07600
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:sgb01007]
    WQO_07600
Enzymes [BR:sgb01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.2  alanine transaminase
     WQO_07600
    2.6.1.66  valine---pyruvate transaminase
     WQO_07600
Amino acid related enzymes [BR:sgb01007]
 Aminotransferase (transaminase)
  Class I
   WQO_07600
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_1_2 DegT_DnrJ_EryC1 Aminotran_5 Beta_elim_lyase Cys_Met_Meta_PP
Motif
Other DBs
NCBI-ProteinID: ALU93228
UniProt: A0A0U3L9X4
LinkDB All DBs
Position
1728935..1730146
Genome map
AA seq 403 aa AA seqDB search
MEFRQSSKLNEVCYEIRGPVIEHANALEEAGHSVLRLNTGNPALFGFEAPEEIVQDMIRM
LPQAHGYTDSRGILSARRAVAQRYQSMGLTEVGVDDVFLGNGVSELISMAVQALLEDGDE
VLIPAPDFPLWTAVTTLAGGKAVHYVCDEESDWNPDLADMAAKITDRTKAVVIINPNNPT
GAVYPREILEGILDLARRHGLMVFADEIYDQILYDGAEHHSAAVLAPDLVCLTFSGLSKT
YRVAGFRSGWMVVSGPHQHARNYLEGLTMLASMRLCPNAPAQYAIQAALGGRQSIKELVA
PGGRLHEQRDRAWERLNEIPGVSCVKPKGALYAFPRIDPKVHPIVDDEKFVLDLLLREKI
QVVQGTGFSWPRPDHFRILTLPHADDLDAAISRIGRFLNGYRQ
NT seq 1212 nt NT seq  +upstreamnt  +downstreamnt
atggagttccggcagtccagcaagctcaacgaggtctgctacgagatccggggcccggtc
atcgagcacgccaacgccctggaggaggcgggccacagcgtgctccggctcaacacgggc
aatcccgcgctcttcggcttcgaggcgcccgaggagatcgtccaggacatgatccggatg
ctgccgcaggcccacggctacaccgattcgcgcggcatcctctcggcccggcgggcggtg
gcccagcgctaccagtcgatggggctgaccgaggtcggcgtggacgacgtgttcctcggc
aacggggtctccgagctgatctcgatggccgtgcaggcgctgctggaggacggcgacgag
gtgctgatcccggccccggacttcccgctgtggaccgcggtgaccacgctcgcgggcggc
aaggccgtgcactacgtctgcgacgaggagtccgactggaacccggatctcgccgacatg
gccgccaagatcaccgaccggaccaaggccgtcgtgatcatcaacccgaacaaccccacc
ggcgcggtctatccgcgcgagatcctcgaaggcatcctcgatctggcccggcggcacggg
ctgatggtgttcgccgacgagatctacgaccagatcctgtacgacggggccgagcaccac
agtgcggccgtcctcgccccggacctggtctgcctgaccttcagcggcctgtcgaagacg
taccgggtggccgggttccgctccggctggatggtggtgtccggtccgcaccagcacgcc
cgcaactacctggagggcctgacgatgctggcctccatgcggctgtgccccaacgcgccc
gcgcagtacgccattcaggcagcgctcggaggccggcagtccatcaaggagctggtcgcc
ccgggcgggaggctgcacgaacagcgcgaccgggcctgggagcggctgaacgagatcccc
ggcgtctcgtgcgtgaagccgaaaggtgcgctgtacgccttcccgcggatcgacccgaag
gtccatccgatcgtggacgacgagaagttcgtgctggacctgctgctgcgggagaagatc
caggtggtgcagggcaccggcttcagctggccgcgcccggaccacttccgcatcctgacc
cttccgcacgctgatgatctcgacgcggcgatcagccgcatcggccgcttcctgaacgga
tatcgccagtga

DBGET integrated database retrieval system