KEGG   Streptomyces globisporus: WQO_08900Help
Entry
WQO_08900         CDS       T04209                                 

Definition
(GenBank) glycosidase
  KO
K01176  alpha-amylase [EC:3.2.1.1]
Organism
sgb  Streptomyces globisporus
Pathway
sgb00500  Starch and sucrose metabolism
sgb01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sgb00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    WQO_08900
Enzymes [BR:sgb01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     WQO_08900
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CBM_20 Alpha-amylase Alpha-amylase_C
Motif
Other DBs
NCBI-ProteinID: ALU93465
UniProt: A0A0U3LMV0
LinkDB All DBs
Position
complement(2023514..2025247)
Genome map
AA seq 577 aa AA seqDB search
MARRPLSAALALVAGAAALVVPTGFGAASPAQAAAPGDKDVTAVMFEWKFVSIAKACTDT
LGPAGYGYVQVSPPQEHIQGGQWWTSYQPVSYRIAGRLGDRAAFSAMVNTCHSAGVKVVA
DSVINHMAAGNGTGTGGSAYTKYDYPGLYSGADLDDCRSQITNYNDRGNVQNCELVGLAD
LDTGEDYVRGKIAGYLNDLLSLGVDGFRIDAAKHMPAADLANIKSRLTNPNVYWKQEAIF
GAGEAVSPSEYLGTGDVQEFRYGRSLKQVFLNENLAHLKNFGEGWGFMESGKSGVFVDNH
DTERNGETLNYKNGSAYTLANVFMLAYPYGSPDVHSGYEFSDHDAGPPGGGQVNACYSDG
WKCQHAWREISSMVGFRNAARGQSVTNWWDNGGDQIAFGRGSKAYVAINHEGSALNRTFQ
TSLPAGDYCDVQSGKGVTVNGSGQFTATVPAGTAVALHANARTCSGGGGTNPDPGPGNGS
SGASFGVNATTQPGQNIHVTGDQAALGNWNPANAPKLDPAAYPVWKLDVALPAGTTFAYK
YVRKDAAGNVTWESGANRTATVPASGKVTLTADVWRA
NT seq 1734 nt NT seq  +upstreamnt  +downstreamnt
atggcacgcagaccactgtctgccgcgctcgccctcgtggccggcgccgccgccctcgtc
gtccccaccggattcggcgccgcgtcccccgcgcaggccgccgctccgggcgacaaggac
gtcaccgccgtgatgttcgagtggaagttcgtctccatagccaaggcctgcacggacacc
ctcggtccggcgggctacggctacgtccaggtctcgccgccccaggagcacatccagggc
ggccagtggtggacctcctaccagcccgtcagctacaggatcgccgggcggctcggtgac
cgggcggccttctccgccatggtcaacacgtgtcactcggcgggcgtgaaggtcgtcgcc
gactctgtcatcaaccacatggcggcgggcaacggcaccggcaccggcggctccgcgtac
accaagtacgactacccgggcctctactccggcgccgacctggacgactgccgctcccag
atcaccaactacaacgaccgcggcaacgtccagaactgcgagctggtcggcctcgccgac
ctggacaccggcgaggactacgtacgcggcaagatcgccgggtacctcaacgacctgctc
tcgctcggcgtggacggcttccgcatcgacgccgcgaagcacatgcccgccgccgacctg
gccaacatcaagtcccggctgaccaacccgaacgtctactggaagcaggaggcgatcttc
ggggcgggcgaggccgtctcgccctccgaatacctcggcaccggggacgtccaggagttc
cggtacgggcggagcctcaagcaggtcttcctcaacgagaacctcgcccacctgaagaac
ttcggcgagggctggggcttcatggagtccggcaagtccggcgtcttcgtcgacaaccac
gacaccgagcggaacggcgagaccctcaactacaagaacggctccgcctacacgctcgcc
aacgtcttcatgctggcctacccctacggctccccggacgtccactccggctacgagttc
agcgaccacgacgccgggccgcccggcggcggccaggtcaacgcctgctacagcgacggc
tggaagtgccagcacgcctggcgcgagatctcctccatggtcggtttccgcaacgcggcg
cgcggccagtccgtcaccaactggtgggacaacggcggcgaccagatcgccttcggccgg
ggcagcaaggcgtacgtcgccatcaaccacgagggctccgcgctgaaccggaccttccag
acctcgctgcccgccggcgactactgcgacgtccagtccggcaagggcgtcaccgtcaac
ggctcgggccagttcaccgccaccgtcccggccggcaccgccgtcgccctgcacgccaac
gcccggacctgctccgggggcggcggcacgaaccccgacccgggccccggcaacggctcc
tccggcgcgtccttcggcgtgaacgccaccacccagcccggccagaacatccacgtcacc
ggcgaccaggccgccctcggcaactggaacccggcgaacgcccccaagctcgacccggcc
gcgtaccccgtctggaagctcgacgtcgccctgcccgccgggaccacgttcgcctacaag
tacgtccgcaaggacgcggccggcaacgtcacctgggagagcggcgccaaccgcaccgcc
accgtcccggcctccgggaaggtcacgctgaccgccgacgtctggcgcgcctga

DBGET integrated database retrieval system