KEGG   Streptomyces globisporus: WQO_09485Help
Entry
WQO_09485         CDS       T04209                                 

Definition
(GenBank) aldehyde dehydrogenase
Organism
sgb  Streptomyces globisporus
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh
Motif
Other DBs
NCBI-ProteinID: ALU93570
UniProt: A0A0U3LSD8
LinkDB All DBs
Position
complement(2157990..2159459)
Genome map
AA seq 489 aa AA seqDB search
MTELTELVEHGQLFIGGEFTDPLGTEVIEVISPHTEQVIGRVPHASEGDVDRAVAAARRA
FDEGPWPRMSLDERIAVITRIKDAFAVRHEEFARLISAQNGTPYSASVMVQALAAMMVWD
SAITLARAFPYEERRDGVLGPLLVRREPVGVVAAVVPWNVPQFTAAAKLAPALLAGCTAV
LKVSPETPLDAYVLAEIAEEAGLPPGVLSILPADREVSEYLVGHPDVDKVSFTGSVAAGR
RVMEVASRNLTRVTLELGGKSAAVILPDADLEAAVAGIVPFAWMINGQACVAQTRILAPR
SRYEEVAEAFAAAAGALRVGDPLDPTTELGPLVARRQQQRSLDYIRLGQEEGAKILTGGN
VPASQERGWYVEPTLFGSVDNSMRIAREEIFGPVICLIPYGDEAEAVRIADDSPYGLSGS
VWTADTERGIDIARRVRTGTYSVNTFSLDMLGPFGGYKNSGLGREFGPEGYGEFFEHKMI
HLPAGYREA
NT seq 1470 nt NT seq  +upstreamnt  +downstreamnt
atgacggaacttacggagcttgtggaacacggacagctgttcatcggcggggagttcacc
gatccgctcggcaccgaggtcatcgaggtgatctccccgcacaccgaacaggtcatcggc
cgcgtgccgcacgcgtccgagggggacgtggaccgcgcggtcgccgccgcccgccgcgcc
ttcgacgagggcccctggccgaggatgagcctggacgagcggatcgcggtgatcacccgg
atcaaggacgccttcgccgtacgccacgaggagttcgcgcgcctgatcagcgcgcagaac
ggcaccccgtacagcgcgagcgtcatggtgcaggcactggccgcgatgatggtctgggat
tcggcgatcacgctggcgcgggcgttcccgtacgaggaacggcgcgacggcgtcctcggc
ccgctgctggtccgccgtgaaccggtgggggtggtggcggcggtcgtcccatggaacgtc
ccgcagttcacggcggcggcgaagctggccccggcgctgctggcgggttgcacggcggtg
ttgaaggtctccccggaaaccccactggacgcgtatgtgttggcggagatagcagaagag
gcgggcctgccgcccggagtcctctccatcctcccggccgaccgggaggtgagcgagtac
ctggtgggccatccggacgtggacaaggtctccttcaccggctcggtggcggccggccgc
cgggtgatggaggtggcgtcgcgcaacctgacccgcgtcactttggagttgggcggcaaa
tcggcagcagtcatcctcccggacgcggacctggaggcggcggtggcggggatcgtcccg
ttcgcgtggatgatcaacggccaggcgtgcgtggcgcagacgcgcatcctggcgccacgc
agccgctacgaggaagtagcggaggcgttcgcggcagcggccggagccctgcgggtgggc
gaccccttggacccgacaacggaactgggcccgctggtggcccgacgccagcagcaacgc
tctctggactacatcaggttgggccaggaggagggcgccaagatcctcacgggcggcaac
gtgccggcctcccaggagcgcggctggtacgtcgaacccaccctcttcggttcggtcgac
aactcgatgcgcatcgcccgcgaggagatcttcggcccggtcatctgcctgatcccgtac
ggggacgaggccgaggcggtccgcatcgccgacgactccccgtacggcctcagcggcagc
gtctggacggcggacacggaacgcggcatcgacatcgcccgccgggtccgcacgggcacg
tacagcgtgaacaccttcagcctggacatgctcggcccgttcggcggctacaagaactcg
ggcctgggccgcgagttcggccccgagggctacggcgagttcttcgagcacaagatgatc
cacctgcccgccggctaccgggaggcgtga

DBGET integrated database retrieval system