KEGG   Streptomyces globisporus: WQO_12740Help
Entry
WQO_12740         CDS       T04209                                 

Definition
(GenBank) serine/threonine protein kinase
Organism
sgb  Streptomyces globisporus
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Kdo APH Kinase-like PhoR Pkinase_fungal
Motif
Other DBs
NCBI-ProteinID: ALU94137
UniProt: A0A0U3LQ22
LinkDB All DBs
Position
complement(2952972..2954639)
Genome map
AA seq 555 aa AA seqDB search
MRPVGSKYLLEEPLGRGATGTVWRARQRETAGAEAAVAGQPGETVAIKVLKEELANDADV
VMRFLRERSVLLRLTHPNIVRTRDLVVEGDLLALVMDLIDGPDLHRYLRENGPLTPVAAA
LLTAQIADALAASHADGVVHRDLKPANVLLDERDGGMTPMLTDFGIARLADSPGLTRTHE
FVGTPAYVAPESAEGRPQTSAVDIYGAGILLYELVTGRPPFAGGTALEVLHRHLSEEPRR
PSTVPDPLWTVIERCLRKDPDQRPSAENLARGLRTVASGIGVHANSAQIAAAEGVGALLA
PDPAPTAVPDTPGAADPTQVLPSNAGSYDPAAATSVLPQTGPGGQGQGGNQGHADPTAVM
PPVPQRPDGPPQPDGPHPWQSQLQAARDRNEQTQVQYLDPSQDPLRRRPQRQQPPQQPPQ
RQQQPVQRRQQPLQQQYPYQQQQQPQRYQQPQQPQRQQYAPPQPQQPAARPPREPRPPRQ
RSANPMRIPGLGCLKGCLFTLVLLVVAGWLIWELTPLQDWVAQGKGYWEAIGDAIGTVTD
WFSKLGDSAGGSGGA
NT seq 1668 nt NT seq  +upstreamnt  +downstreamnt
gtgcggcctgtaggcagcaagtacctgctcgaggagccgctcgggcgcggtgccacgggc
accgtctggcgagcccgccagcgggagaccgcgggcgccgaggcggccgtcgcgggtcag
cccggcgagaccgtggccatcaaggtcctcaaggaggagctggccaacgacgccgacgtg
gtgatgcggttcctgcgggagcgctcggtcctgctgcggctcacgcacccgaacatcgtg
cgcacccgggacctcgtcgtcgagggcgatctcctcgccctggtcatggacctgatcgac
ggccccgacctgcaccgctacctccgtgagaacggcccgctcaccccggtcgccgccgcc
ctgctcaccgcgcagatcgcggacgcgctcgccgccagccacgccgacggcgtcgtccac
cgcgacctcaagcccgccaacgtgctcctcgacgagcgtgacggcggcatgaccccgatg
ctcaccgacttcggcatcgcgcggctcgccgactccccgggtcttacccggactcacgag
ttcgtcggcacgcccgcctatgtggcgccggagtccgccgagggacgcccgcagacctcc
gccgtcgacatctacggcgcgggcatcctgctgtacgagctggtcaccggccgtccgccg
ttcgccgggggcaccgccctcgaagtcctgcaccggcacctcagcgaggagccccgccgg
ccctccaccgtccccgacccgctgtggacggtcatcgagcgctgcctgcgcaaggacccg
gaccagcggcccagcgccgagaacctggcccgtggtctgcgtacggtcgcctccggcatc
ggcgtccacgcgaactccgcccagatcgccgccgccgaaggcgtgggcgccctgctcgcc
cccgacccggcgcccacggccgtcccggacaccccgggcgcggccgaccccacgcaggtc
ctgccgagcaacgcgggctcctacgaccccgccgcggccaccagcgtgctcccgcagacc
ggccccgggggacagggccagggtggcaaccagggccacgccgacccgaccgccgtcatg
ccgcccgtgccgcagcgccccgacgggccgccgcagccggacggcccgcacccctggcag
tcgcagctccaggcggcccgtgaccgcaacgagcagacccaggtgcagtacctggacccg
agccaggacccgctgcgccgccgcccccagcgccagcagccgccgcagcagcctccccag
cggcagcagcagcccgtgcagcgcaggcagcagccgctccagcagcagtacccataccag
cagcagcaacagccgcagcgctaccagcagccgcagcagccccagcggcagcagtacgcg
cccccgcagccccagcagccggccgcccggccgccgcgcgagccgcgtccgccgcgccag
cgcagcgccaacccgatgcgcatccccgggctcggctgcctcaagggctgtctgttcacc
ctggtgctcctggtcgtcgccggctggctgatctgggagctgaccccgctccaggactgg
gttgcccagggcaagggctactgggaagcgatcggcgacgcgatcggcacggtcaccgac
tggttctccaagctcggcgacagcgccggaggctcgggcggggcctga

DBGET integrated database retrieval system