KEGG   Streptomyces globisporus: WQO_29195Help
Entry
WQO_29195         CDS       T04209                                 

Definition
(GenBank) isocitrate dehydrogenase
  KO
K00031  isocitrate dehydrogenase [EC:1.1.1.42]
Organism
sgb  Streptomyces globisporus
Pathway
sgb00020  Citrate cycle (TCA cycle)
sgb00480  Glutathione metabolism
sgb01100  Metabolic pathways
sgb01110  Biosynthesis of secondary metabolites
sgb01120  Microbial metabolism in diverse environments
sgb01130  Biosynthesis of antibiotics
sgb01200  Carbon metabolism
sgb01210  2-Oxocarboxylic acid metabolism
sgb01230  Biosynthesis of amino acids
Module
sgb_M00009  Citrate cycle (TCA cycle, Krebs cycle)
sgb_M00010  Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
Brite
KEGG Orthology (KO) [BR:sgb00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    WQO_29195
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    WQO_29195
Enzymes [BR:sgb01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.42  isocitrate dehydrogenase (NADP+)
     WQO_29195
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IDH Pr_beta_C
Motif
Other DBs
NCBI-ProteinID: ALU97053
UniProt: A0A0U3KDR6
LinkDB All DBs
Position
6608013..6610235
Genome map
AA seq 740 aa AA seqDB search
MTDSTIIYTHTDEAPALATYSFLPVVEAYASTAGVTVERRDISLAGRIIASFPEHLKAEQ
RIDDALAELGELARTPGANIIKLPNISASIPQLKAAIAELQEQGYALPDYPDDPRTDAEK
DVRARYDKVKGSAVNPVLREGNSDRRAPASVKNYAKAHPHRMGAWTADSKTNVATMGVDD
FRSTEKSAVVAEDGTLRIELHGDDGTTTVLRESVPVLKGEVVDAAVMRVAALREFFTAQV
ARAKAEGVLFSLHLKATMMKVSDPIIFGHAVRAFFPNTFAKYGDQLAAAGLTPNDGLGGI
LKGLGSLPDVGAEIQASFEAELAEGPALAMVDSDKGITNLHVPSDVIVDASMPAMIRTSG
HMWGPDGNEADTIAVLPDSSYAGVYQVVIDDCRANGAFDPATMGSVPNVGLMAQKAEEYG
SHDKTFEIPATGTVRVVDASGAVVLEQAVGAGDIFRMCQTKDLPIQDWVKLAVTRARATG
NPAVFWLDETRAHDANLIAKVTTYLADHDTDGLDISVKSPEEATAFSLERIRRGEDTISV
TGNVLRDYLTDLFPILELGTSAKMLSVVPLMNGGGLFETGAGGSAPKHVQQLVKENYLRW
DSLGEFLALAVSFEHLATTTDNARAQVLADTLDRATGTFLNEDKSPSRRLGGIDNRGSHF
YLALYWAQELAQQTDDAKLAEAFAPLAKTLAEQEETIVAELVAVQGSPAEIGGYFQPDPA
KAAAVMRPSATFNNAIASLA
NT seq 2223 nt NT seq  +upstreamnt  +downstreamnt
gtgactgactcgaccatcatctatacgcacaccgacgaggcccctgccctggcgacctac
tcgttcctgcccgtcgtcgaggcctacgcctcgaccgcgggtgtcacggtcgagcgccgt
gacatctccctcgcgggccggatcatcgccagtttcccggagcacctcaaggccgagcag
cgtatcgatgacgcactcgccgagctgggcgagctggccaggacgcccggcgcgaacatc
atcaagctgccgaacatctcggcgtcgatcccgcagctcaaggcggccatcgccgagctg
caggagcagggctacgcgcttccggactacccggacgacccgcggaccgacgcggagaag
gacgtccgcgcccgctacgacaaggtcaagggcagcgccgtgaacccggtgctgcgcgag
ggcaactccgaccgccgcgcccccgcctccgtcaagaactacgccaaggcccacccgcac
cgcatgggcgcctggacggccgactcgaagacgaacgtcgccaccatgggcgtcgacgac
ttccgctccaccgagaagtccgcggtcgtcgccgaggacggcacgctccgcatcgagctg
cacggcgacgacggcaccaccaccgtgctccgcgagtccgtacccgtcctgaagggcgag
gtcgtcgacgcggccgtcatgcgcgtcgccgcgctgcgcgagttcttcaccgcgcaggtc
gcccgcgccaaggccgagggcgtgctgttctccctgcacctcaaggccaccatgatgaag
gtctccgacccgatcatcttcggccacgcggtccgcgccttcttcccgaacaccttcgcc
aagtacggcgaccagctcgccgccgccggcctcacccccaacgacggtctgggcggcatc
ctcaagggcctcggctcgctgccggacgtcggcgccgagatccaggcgtccttcgaggcc
gagctcgccgagggccccgccctcgcgatggtcgactccgacaagggcatcaccaacctg
cacgtccccagcgacgtcatcgtcgacgcctccatgcccgccatgatccgcacctcgggt
cacatgtggggcccggacggcaacgaggccgacaccatcgccgtcctcccggacagcagc
tacgccggtgtctaccaggtcgtcatcgacgactgccgcgccaacggcgccttcgacccc
gccaccatgggctcggtgcccaacgtcggtctgatggcgcagaaggccgaggagtacggc
agccacgacaagaccttcgagatccccgccaccggcaccgtgcgcgtcgtcgacgcgagc
ggcgcggtcgtgctggagcaggccgtcggcgccggcgacatcttccgcatgtgccagacc
aaggacctgccgatccaggactgggtcaagctcgccgtcacccgcgcccgcgccaccggc
aacccggccgtgttctggctggacgagacccgcgcgcacgacgccaacctgatcgccaag
gtgacgacgtacctcgccgaccacgacacggacggcctggacatctccgtcaagtccccg
gaagaggccaccgccttctccctggagcgcatccgccgcggcgaggacaccatctccgtc
accggcaacgtgctccgcgactacctcacggacctcttcccgatcctggagctgggcacc
agcgccaagatgctctccgtggtcccgctgatgaacggcggcggccttttcgagaccggc
gcgggcggctcggcccccaagcacgtccagcagctcgtcaaggagaactacctccgctgg
gacagcctgggcgagttcctggccctcgcggtcagcttcgagcacctggccaccaccacg
gacaacgcgcgggcccaggtcctcgccgacaccctggaccgggccacgggcaccttcctc
aacgaggacaagtcgccgagccgtcgcctcggcggcatcgacaaccgcggcagccacttc
tacctggccctctactgggcccaggagctggcgcagcagaccgacgacgccaagctcgcc
gaggcgttcgcgccgctcgccaagaccctggccgagcaggaggagaccatcgtcgccgag
ctggtcgcggtgcagggctccccggccgagatcggcggctacttccagcccgacccggcc
aaggccgcggcggtcatgcgcccgtccgccacgttcaacaacgcgatcgcgtccctcgcc
tga

DBGET integrated database retrieval system