KEGG   Streptomyces globisporus: WQO_30485Help
Entry
WQO_30485         CDS       T04209                                 

Definition
(GenBank) ATP-dependent DNA ligase
Organism
sgb  Streptomyces globisporus
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_C RNA_ligase
Motif
Other DBs
NCBI-ProteinID: ALU97291
UniProt: A0A0U3LPY5
LinkDB All DBs
Position
complement(6900652..6901713)
Genome map
AA seq 353 aa AA seqDB search
MDLPVMPPVKPMLAKSVAKIPPGMAYEAKWDGFRAIVYRDGDQVEIGSRTGKSLTRYFPD
LVDAVRDNLPPRCVIDGEIVIAHEGRLDFERLSERIHPADSRVRMLAEQTPASFIAFDVL
AIDDTSLLSTPQADRRAVLTAALSGASAPVLLAPSTTDIEVAREWFDRYEGAGLDGVVAK
PLDLPYRPDTRAMYKIKHERTADVVVAGYREHKSGPVVGSLLLGLYDTGGVLQHVGVCAA
FPMKRRAELAEELAPLRCEFAEHPWGAWADAAAHEQSRLPGTQNRWTGKKDQSWVPLRPE
RVCEVAYDHMEGDRFRHTTQFRRWRPDRSPASCTYAQLEEVVSYDLSEVLSGG
NT seq 1062 nt NT seq  +upstreamnt  +downstreamnt
atggacctgccggtgatgccgcccgtgaagccgatgctcgccaagtcggtggccaagatc
ccgccaggcatggcgtacgaggcgaagtgggacggcttccgggcgatcgtctaccgggac
ggcgatcaggtcgagatcggcagccgtacgggcaagtccctgacccgctacttccccgat
ctggtcgacgccgtacgggacaacctcccgccgcgctgtgtgatcgacggagagatcgtc
atcgcccacgaggggcggctcgacttcgagcggctcagcgagcgcatccatccggcggac
tcccgggtgcggatgctcgccgagcagaccccggcgagcttcatcgccttcgacgtcctc
gcgatcgacgacacctccctgttgagcaccccgcaggcggaccggcgggccgtgctgacg
gccgccctctccggcgcctccgcgcccgtgctcctcgccccgtccaccacggacatcgag
gtcgcccgggagtggttcgaccggtacgagggggccgggctcgacggggtcgtggccaag
ccgctcgacctgccctaccggcccgacacccgcgcgatgtacaagatcaagcacgagcgg
accgccgacgtcgtggtggcgggctaccgcgagcacaagagcggcccggtcgtcggctcg
ctcctgctcggcctgtacgacaccggtggcgtgctccagcacgtcggggtctgcgcggcc
ttccctatgaagcggcgtgccgagctggccgaggaactcgccccgctgcgctgcgagttc
gccgagcacccgtggggcgcctgggcggacgcggcggcgcacgagcagtcgcggctgccg
ggaacccagaaccgctggacgggcaagaaggaccagtcctgggtgccgctgcgcccggag
cgggtctgcgaggtggcgtacgaccacatggagggcgaccggttccggcacaccacccag
ttccgccggtggcggccggaccggtcccccgcgagctgtacgtacgcgcagttggaggag
gtcgtctcctacgatctgtccgaggtgctgtcaggcggctga

DBGET integrated database retrieval system