KEGG   Streptomyces globisporus: WQO_33900
Entry
WQO_33900         CDS       T04209                                 

Definition
(GenBank) methyltransferase
  KO
K21178  O-methyltransferase [EC:2.1.1.-]
Organism
sgb  Streptomyces globisporus
Pathway
sgb01059  Biosynthesis of enediyne antibiotics
sgb01100  Metabolic pathways
sgb01110  Biosynthesis of secondary metabolites
Module
sgb_M00826  C-1027 benzoxazolinate moiety biosynthesis, chorismate => benzoxazolinyl-CoA
Brite
KEGG Orthology (KO) [BR:sgb00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   01059 Biosynthesis of enediyne antibiotics
    WQO_33900
Enzymes [BR:sgb01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.-  
     WQO_33900
SSDB
Motif
Pfam: Methyltransf_2 Methyltransf_25 MTS Methyltransf_31 Dimerisation2 Methyltransf_12 HTH_IclR Dimerisation HTH_20 HTH_28 HTH_Crp_2 Rrf2 HTH_45
Other DBs
NCBI-ProteinID: ALU98445
UniProt: A0A0U3KHX7
LinkDB
Position
SGLP1:60170..61171
AA seq 333 aa
MGDEDGKAAELWSMANLGTPMAVRVAATLRIADHITAGAHTAGEIAEAAAVHEESLDRLL
RYLTVRGLLDRDGLGRYTLTPLGRPLCEDHPAGVRAWFDMEGAGRGELSFVDLLHSVRTG
KAAFPLRYGRPFWEDLAEDPRRAESFNRLLGQDVATRAPAVVAGFDWASTGHVIDLGGGD
GSLLTALLTACPSLRGTVLDLPEAVQRAKESFAVSGLDDRANAVAGSFFDALPAGAGAYV
LSLVLHDWDDEASVAILRRCAEAAGQTGSVFVIESTGSAGDAPHTGMDLRMLCIYGAKER
RVEEFEELAGRAGLRVVAVHPAGPSAIIQMSAV
NT seq 1002 nt   +upstreamnt  +downstreamnt
ttgggcgatgaggacggcaaggccgccgagctgtggtcgatggcgaacctgggtacaccg
atggccgtgcgcgtcgcggcgaccctgcgcatcgccgaccacatcacggccggagcgcac
accgccggcgaaatcgccgaagcggccgccgtgcacgaggaatccctcgaccggctgctg
cgctacctcaccgtccggggcctgctggaccgtgacgggctcggccggtacacgctgacc
cccctgggccggccgctgtgcgaggaccaccccgccggcgtccgggcctggttcgacatg
gagggagcggggcggggcgagctgtcgttcgtcgacctgctgcacagcgtacggaccggg
aaggccgccttccccctgcgctacggccgccccttctgggaggacctggcggaggacccc
cgccgcgcggagtccttcaaccggctgctcggccaggacgtcgccactcgcgccccggcc
gtggtggccggcttcgactgggcgagcaccggtcatgtcatcgacctcggaggcggcgac
ggctccctgctgaccgcactgctgaccgcctgtccgtcactgcgcggcacggtcctggac
ctgcccgaagcggtgcagcgtgccaaggagtcgttcgccgtgtccggactggacgaccgg
gcgaacgcggtcgcgggcagcttcttcgacgccctccccgccggcgcgggcgcctacgtc
ctgtccctggtcctgcacgactgggacgacgaggcgtccgtcgcgatcctgcggcgctgc
gccgaggcggcggggcagacgggatcggtgttcgtcatcgagtcgaccggctcggcgggg
gacgccccgcacacaggtatggacctgcgcatgctgtgcatctacggagccaaggagcgc
cgcgtggaggagttcgaggaactcgccggccgggccgggctccgggtcgtcgccgtccac
cccgcgggcccttccgcgatcatccagatgtccgcggtctga

DBGET integrated database retrieval system