KEGG   Streptococcus agalactiae GD201008-001 (serotype Ia): A964_0708Help
Entry
A964_0708         CDS       T02248                                 

Gene name
malS
Definition
(GenBank) alpha-amylase
  KO
K01176  alpha-amylase [EC:3.2.1.1]
Organism
sgc  Streptococcus agalactiae GD201008-001 (serotype Ia)
Pathway
sgc00500  Starch and sucrose metabolism
sgc01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sgc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    A964_0708 (malS)
Enzymes [BR:sgc01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     A964_0708 (malS)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Alpha-amylase DUF1939 Glyco_hydro_70
Motif
Other DBs
NCBI-ProteinID: AFS45486
LinkDB All DBs
Position
730321..731787
Genome map
AA seq 488 aa AA seqDB search
MTNELIMQAFEWYLPSDGNHWKKLEESISDLKKLGISKIWLPPAFKGTSSDDVGYGVYDL
FDLGEFDQNGTIRTKYGRKEEYLKLIKSLKANGIKPFADIVLNHKANGDHKEKFQVIKVN
PENRQEALSEPYEIEGWTGFDFPGRQGEYNDFKWHWYHFTGLDYDAKNNETDIFMIVGDN
KGWADDDLIDDENGNFDYLMYNDIDFKHPEVIKNLQDWAKWFIETTGIEGFRLDAVKHID
SYFIQTFINDIRTKIKPDLEVFGEYWKSDQTSMKDYLEATQFQFSLVDVTLHMNFFDASH
QNRDFDMRTIFDDSLVIDNPEYAVTFVENHDTQSGQALESRVEDWFKPLAYGLILLRQQG
TPCLFYGDYYGIQGEFGQPSFKEVIDKMAELRQNYVFGKQVDYFTHSNCIGWTCLGDEEH
NSCLAVVLTNGDQGWKHMEVGEIYAGKTFVDYLGNCEQEVVIGDDGWGDFLVESASISAW
VPKIEEAN
NT seq 1467 nt NT seq  +upstreamnt  +downstreamnt
atgacaaatgaattgataatgcaagcttttgagtggtatttacctagtgatgggaatcac
tggaagaaattagaggagtctatatcagaccttaaaaaacttggaattagtaaaatttgg
ttaccaccagcatttaagggaactagcagtgatgatgtaggatatggtgtttatgatctc
tttgatttaggagaatttgaccagaatggaacaattagaacaaaatatggtaggaaagaa
gagtatctaaagcttattaagtcgttaaaggcaaatggcattaaaccgtttgcagatatc
gttcttaaccataaagccaatggtgatcataaagaaaaatttcaagtcatcaaagtcaat
cctgaaaatcgtcaagaagcattaagtgaaccctatgagattgaaggatggacgggattt
gatttcccaggtagacagggtgagtacaatgattttaaatggcactggtaccactttact
ggtttagattacgatgctaaaaataatgaaacagacatctttatgattgtaggcgataat
aaaggttgggcagacgatgatttgattgatgatgaaaatggtaatttcgattatctcatg
tacaatgacattgattttaagcatcctgaagttataaaaaacttacaagattgggctaag
tggtttattgaaactacaggcattgaaggttttcgtttggatgctgtgaaacatatcgat
tcttactttattcaaactttcattaatgatattcgtacaaaaataaaacccgatttagag
gtctttggcgaatattggaaatctgaccaaacatcaatgaaggactatttagaggcaaca
caatttcaattttctcttgttgatgttaccttacatatgaatttttttgatgccagtcac
caaaaccgtgattttgatatgcgaacaatttttgatgatagtcttgttattgataatcct
gagtatgctgttacattcgtagaaaatcatgatacgcaaagtggacaagctctagaaagt
agagtggaagattggtttaaacctttagcttatggcttgatacttttacgccaacaaggg
actccatgtcttttttatggtgattactatggcattcaaggagaatttggtcaaccatcc
tttaaagaggttattgataaaatggctgagctacgccaaaactatgtatttggcaaacaa
gtcgattattttacgcattcaaattgtattggttggacttgtcttggggatgaggaacat
aattcttgtttagctgtggtcctaacaaatggtgatcagggatggaaacatatggaagta
ggggaaatttatgcaggcaaaacgtttgttgattatttaggtaattgtgaacaagaggtt
gttataggagatgatggttggggtgattttttagttgaatctgcgtctatctcggcttgg
gttcctaaaatagaggaagctaactga

DBGET integrated database retrieval system