KEGG   Streptococcus agalactiae GD201008-001 (serotype Ia): A964_0791Help
Entry
A964_0791         CDS       T02248                                 

Gene name
sodB
Definition
(GenBank) superoxide dismutase
  KO
K04564  superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
sgc  Streptococcus agalactiae GD201008-001 (serotype Ia)
Brite
Enzymes [BR:sgc01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     A964_0791 (sodB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Fe_C Sod_Fe_N
Motif
Other DBs
NCBI-ProteinID: AFS45565
LinkDB All DBs
Position
817682..818290
Genome map
AA seq 202 aa AA seqDB search
MAIILPDLPYAYDALEPHIDAETMTLHHDKHHATYVANANAALEKHPEIGEDLEALLADV
SQIPEDIRQAVINNGGGHLNHALFWELMSPEETQISQELSEDINATFGSFEDFKAAFTAA
ATGRFGSGWAWLVVNAEGKLEVLSTANQDTPIMEGKKPILGLDVWEHAYYLNYRNVRPNY
IKAFFEIINWNKVNELYQAAKA
NT seq 609 nt NT seq  +upstreamnt  +downstreamnt
atggcaattattttaccagatttaccctatgcatatgatgcgcttgagccacatattgat
gctgagacaatgacactacatcatgataagcaccatgcaacttatgttgctaatgcaaat
gctgctcttgagaaacatcctgaaattggagaagacttagaggcgctcttagctgatgtt
tctcaaattccagaagatattcgtcaggcagtcatcaataacggtggtggacatcttaac
cacgctcttttctgggaattgatgtcaccagaagaaactcaaatttcacaagagttatct
gaagacattaatgcaacttttggttcatttgaagactttaaagctgctttcacagcagca
gcaacaggacgttttggttcaggttgggcttggcttgttgttaatgctgaaggcaaactt
gaagtgctttcaactgccaatcaagatactccaattatggaaggcaagaaacctatttta
gggcttgatgtatgggagcatgcttattacttaaactatcgtaatgttcgtcctaactac
atcaaagctttctttgaaattattaactggaataaagtaaatgaactttaccaagctgct
aaagcttaa

DBGET integrated database retrieval system