KEGG   Streptococcus agalactiae GD201008-001 (serotype Ia): A964_0883Help
Entry
A964_0883         CDS       T02248                                 

Gene name
aceF
Definition
(GenBank) branched-chain alpha-keto acid dehydrogenase subunit E2
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
sgc  Streptococcus agalactiae GD201008-001 (serotype Ia)
Pathway
sgc00010  Glycolysis / Gluconeogenesis
sgc00020  Citrate cycle (TCA cycle)
sgc00620  Pyruvate metabolism
sgc01100  Metabolic pathways
sgc01110  Biosynthesis of secondary metabolites
sgc01120  Microbial metabolism in diverse environments
sgc01130  Biosynthesis of antibiotics
sgc01200  Carbon metabolism
Module
sgc_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:sgc00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    A964_0883 (aceF)
   00020 Citrate cycle (TCA cycle)
    A964_0883 (aceF)
   00620 Pyruvate metabolism
    A964_0883 (aceF)
Enzymes [BR:sgc01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     A964_0883 (aceF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh E3_binding Biotin_lipoyl HlyD_3 Biotin_lipoyl_2 PYNP_C PLA2_B
Motif
Other DBs
NCBI-ProteinID: AFS45655
LinkDB All DBs
Position
918745..920133
Genome map
AA seq 462 aa AA seqDB search
MAVEIIMPKLGVDMQEGEILEWKKQVGDVVNEGDVLLEIMSDKTNMEIEAEDSGVLLKIT
HGNGDVVPVTETIGYIGAEGEEVTEASSSENTSVEENATQVTSEPEKVEETSEPSVPAAT
SGEKVRATPAARKLAREMSIDLALVSGTGANGRVHREDVENFKGAQPRITPLARRIAEDQ
GVDIAEITGSGIRGKIVKNDVLAAMSPQAAEAPVETKATPTTEEKQLPEGVEVIKMSAMR
KAISKGMTNSYLTAPSFTLNYDIDMTEMMALRKKLIDPIMAKTGLKVSFTDLIGMAVVKT
LMKPEHRYLNASLINDAQEIELHNFVNIGIAVGLDDGLIVPVVHNADQMSLSDFVIASKD
VIKKTQEGKLKSAEMSGSTFSITNLGMFGTKTFNPIINQPNSAILGVGATIPTPTVVDGE
IVARPIMAMCLTIDHRIVDGMNGAKFMVDLKNLMENPFGLLI
NT seq 1389 nt NT seq  +upstreamnt  +downstreamnt
atggctgtcgaaattattatgcctaaactcggggttgatatgcaagaaggcgaaatcctt
gagtggaaaaaacaggtaggtgatgttgttaatgaaggtgacgtcctacttgaaattatg
tcagataaaacaaatatggagattgaagcagaagactcaggtgttttactaaaaatcaca
catgggaatggagatgttgttcctgtaactgagacaattggttatattggtgctgaaggt
gaagaagtaacagaagcatcttcttctgaaaatacatcagttgaagaaaacgcgacacaa
gtaacttcagaaccagaaaaagttgaagaaacatcagaaccaagtgtgccagcagctaca
agtggtgaaaaagtacgtgccactcctgcagctcgtaaattagcaagagagatgtctatt
gaccttgcactagtatctggaacaggggcaaatggtcgcgttcacagagaagatgttgaa
aacttcaagggtgctcaaccacgtattacaccattggcacgtcgaattgctgaagatcaa
ggagttgatatagcagaaatcactggcagtggtattcgtggtaaaattgttaaaaatgat
gttttggctgctatgtcaccgcaagcagcagaggctcctgtagaaactaaagctacacca
acaacagaagaaaaacaattaccagaaggtgttgaagtcattaagatgtctgcaatgcgt
aaggctatttctaaaggtatgactaactcttacctcactgctccaagctttacacttaac
tatgacattgatatgactgaaatgatggctcttcgcaagaaattaattgatccaatcatg
gctaaaacaggcttgaaagtcagctttactgatttgattggaatggccgttgttaagaca
ttgatgaaaccagagcatcgatacctaaatgcttcattaattaacgatgcacaagaaatt
gagcttcataattttgttaatattggaatcgcagttggtcttgatgatggtttgattgtt
cctgttgttcacaatgctgatcaaatgtcactttctgactttgttatagcatctaaagat
gttattaagaaaactcaagaaggtaaattaaaatcagctgaaatgtcaggttcaacattc
tcaattactaacttaggtatgtttggtactaagacgtttaacccaattatcaatcaaccg
aactcagcaatccttggagtaggagctactattccgactccaacagtggttgatggtgaa
attgtagctcgaccaattatggcaatgtgtttaacaattgaccaccgtattgttgatgga
atgaatggtgctaagtttatggttgatcttaagaacttaatggaaaacccatttggttta
cttatttga

DBGET integrated database retrieval system