KEGG   Streptococcus agalactiae GD201008-001 (serotype Ia): A964_1050Help
Entry
A964_1050         CDS       T02248                                 

Gene name
tdk
Definition
(GenBank) thymidine kinase
  KO
K00857  thymidine kinase [EC:2.7.1.21]
Organism
sgc  Streptococcus agalactiae GD201008-001 (serotype Ia)
Pathway
sgc00240  Pyrimidine metabolism
sgc01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sgc00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    A964_1050 (tdk)
Enzymes [BR:sgc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.21  thymidine kinase
     A964_1050 (tdk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TK KdpD AAA_22 AAA_30 ATPase_2
Motif
Other DBs
NCBI-ProteinID: AFS45818
LinkDB All DBs
Position
complement(1096566..1097135)
Genome map
AA seq 189 aa AA seqDB search
MAQLYYKYGTMNSGKTIEILKVAHNYEEQGKPVVIMTSALDTRDEFGVVSSRIGMRREAV
PISDDMDIFSYIQNLPQKPYCVLIDECQFLSKKNVYDLARVVDDLDVPVMAFGLKNDFQN
NLFEGSKHLLLLADKIDEIKTICQYCSKKATMVLRTENGKPVYEGDQIQIGGNETYIPVC
RKHYFNPDI
NT seq 570 nt NT seq  +upstreamnt  +downstreamnt
ttggctcaactctattataaatatgggacaatgaattctggtaaaaccattgaaatttta
aaagttgctcataactatgaagaacaaggaaaacctgtggttattatgacaagcgccttg
gacactcgagatgaatttggagtcgtttcaagtcgtattggaatgcgtcgtgaagcagtt
ccaatttcagatgatatggacattttctcctatattcagaatttaccacaaaagccttat
tgtgttttaattgatgaatgtcaatttttgagtaagaaaaacgtctacgatttagctaga
gtagtagatgacttagatgtaccagtcatggcttttggtttgaaaaatgatttccaaaac
aatctttttgaaggttcaaaacatttgctattattggccgataagattgatgaaatcaaa
acaatttgccaatactgtagtaagaaagcaaccatggttttaaggacagaaaacggaaaa
cctgtctatgaaggtgatcagatacaaattggtggtaatgaaacatatatcccagtttgt
cgaaaacattattttaatccagatatttaa

DBGET integrated database retrieval system