KEGG   Streptomyces griseorubiginosus: DWG14_00517Help
Entry
DWG14_00517       CDS       T06099                                 

Gene name
davT_1
Definition
(GenBank) 5-aminovalerate aminotransferase DavT
  KO
K00823  4-aminobutyrate aminotransferase [EC:2.6.1.19]
Organism
sge  Streptomyces griseorubiginosus
Pathway
sge00250  Alanine, aspartate and glutamate metabolism
sge00410  beta-Alanine metabolism
sge00640  Propanoate metabolism
sge00650  Butanoate metabolism
sge01100  Metabolic pathways
sge01120  Microbial metabolism in diverse environments
Module
sge_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:sge00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    DWG14_00517 (davT_1)
   00650 Butanoate metabolism
    DWG14_00517 (davT_1)
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    DWG14_00517 (davT_1)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    DWG14_00517 (davT_1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:sge01007]
    DWG14_00517 (davT_1)
Enzymes [BR:sge01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     DWG14_00517 (davT_1)
Amino acid related enzymes [BR:sge01007]
 Aminotransferase (transaminase)
  Class III
   DWG14_00517 (davT_1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_3
Motif
Other DBs
NCBI-ProteinID: AYC36308
UniProt: A0A385ZC18
LinkDB All DBs
Position
complement(594011..595279)
Genome map
AA seq 422 aa AA seqDB search
MTALSPHLRQATPVVAARGEGVHLFDPDGRRFLDFTAGIGVTSTGHCHPKVVAAAQEQVG
SLIHGQYTTVMHEPLRRLVDKLGEVLPTGLDSLFFTNSGSEAVEAALRLARQATGRPNVI
VCHGGFHGRTVAAASMTTSGTRFRSGFSPLMSGVVVTPFPAAYRYGWDEETATRFALTEL
DYTLQTISSPADTAAIIVEPVLGEGGYVPANRTFMEGLRERADRHGFLLILDEVQTGVGR
TGRFWGHDHFGVTPDILVTAKGLASGFPLSGIAASGELMAKAWPGSQGGTYGANAVACAA
ACATLDVVRDENLVENAEAMGKRLRTGLEAVADRTPGIGDVRGLGLMLATEFVTEDGSPD
PETAARVQRAAVDEGLLLLLCGAWNQVVRMIPALVIEETAVDEGLRAWANAVETGTSAAA
AR
NT seq 1269 nt NT seq  +upstreamnt  +downstreamnt
atgaccgcactgtcgccgcaccttcgccaggccacgcccgtggtggcggcccggggcgag
ggcgtccacctcttcgacccggacggccgccgcttcctcgacttcaccgccggcatcggt
gtcaccagcaccggccactgccaccccaaggtcgtggcggcggcccaggagcaggtgggc
tcgctgatccacggccagtacacgaccgtcatgcacgagccgttgcgtcgcctggtcgac
aaactcggtgaggtgctgccgacaggcctcgacagcctgttcttcacgaactccgggagc
gaggccgtcgaggccgctctgcggctcgcccgtcaggccaccggccgcccgaacgtgatc
gtctgtcacggcggcttccacggccgtacggtcgccgccgcctccatgacgacgtcgggc
acccgtttccgctccggcttctccccgctgatgagcggcgtggtcgtgacccccttcccg
gcggcctaccgctacggctgggacgaggagaccgcgacccgcttcgccctgacggagctc
gactacacgctccagacgatctcctcgcccgccgacacggccgcgatcatcgtcgagccg
gtcctcggcgagggcggctacgtgcccgccaaccgcaccttcatggagggactccgggag
cgggcggaccggcacggcttcctgctgatcctcgacgaggtgcagaccggggtgggtcgc
accggccgcttctggggccacgaccactttggggtcacgcccgacatcctcgtcaccgcc
aagggcctggccagcggattcccgctgtccggcatcgccgcctccggggaactgatggcc
aaggcgtggcccggctcgcagggcggaacgtacggcgccaacgcggtcgcctgcgccgcg
gcctgcgcgaccctggacgtcgtacgcgacgagaacctggtcgagaacgccgaagcgatg
ggcaagcggctgcgcaccggccttgaagcggtggccgaccggacgccgggcatcggcgac
gtgcgcggcctcggcctcatgctggccaccgagttcgtcaccgaggacggcagccccgac
ccggagacggcagcccgcgtccagcgcgccgccgtcgacgaggggcttctcctgctgctg
tgcggcgcctggaaccaggtcgtgcgcatgatcccggcgctcgtcatcgaggagacggcg
gtggacgagggcctccgggcctgggcgaacgcggtcgagaccggcacgtccgcagcggca
gcgcgctga

DBGET integrated database retrieval system