KEGG   Streptomyces griseorubiginosus: DWG14_07360Help
Entry
DWG14_07360       CDS       T06099                                 

Definition
(GenBank) Actinorhodin polyketide putative beta-ketoacyl synthase 1
  KO
K05551  minimal PKS ketosynthase (KS/KS alpha) [EC:2.3.1.- 2.3.1.260 2.3.1.235]
Organism
sge  Streptomyces griseorubiginosus
Pathway
sge00253  Tetracycline biosynthesis
sge01056  Biosynthesis of type II polyketide backbone
sge01100  Metabolic pathways
sge01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:sge00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   01056 Biosynthesis of type II polyketide backbone
    DWG14_07360
   00253 Tetracycline biosynthesis
    DWG14_07360
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:sge01004]
    DWG14_07360
   01008 Polyketide biosynthesis proteins [BR:sge01008]
    DWG14_07360
Enzymes [BR:sge01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.235  tetracenomycin F2 synthase
     DWG14_07360
    2.3.1.260  tetracycline polyketide synthase
     DWG14_07360
    2.3.1.-  
     DWG14_07360
Lipid biosynthesis proteins [BR:sge01004]
 Polyketide synthase
  Component type
   DWG14_07360
Polyketide biosynthesis proteins [BR:sge01008]
 Polyketide synthase (PKS)
  Type II PKS
   C7-C12 cyclized polyketide type
    Octaketide PKS
     DWG14_07360
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ketoacyl-synt Ketoacyl-synt_C Thiolase_N XdhC_C
Motif
Other DBs
NCBI-ProteinID: AYC43054
UniProt: A0A101RYT7
LinkDB All DBs
Position
complement(8238720..8239991)
Genome map
AA seq 423 aa AA seqDB search
MTARRVVITGVEVLAPGGVGARKFWELLTEGRTATRGITFFDPSPFRSRVAAEVDFDPYA
HGLTRQEVRRMDRAAQFAVVAARGAVTDSGLALDALDPYRIGVTVGTAVGSTMSLDEDYR
MVSDDGRLDLVDHTYADPYFYNYFVPSSFAAEVARAVGAQGPSSVVSAGCTSGLDSVGYA
AELIREGTADVVVTGATDAPISPITLACFDAIKATTPRNDEPEQASRPFDGTRNGFVLGE
GAAAFVLEELESARRRGARIYAEIAGYATRSNAYHMTGLRADGAEMAEAITVALDEARMN
PTDIDYINAHGSGTKQNDRHETAAFKRSLGDHAYRTPVSSIKSMVGHSLGAIGSIEIAAS
ILAIQHNVVPPTANLHTPDPECDLDYVPLTSRDQLVDAVLTVGSGFGGFQSAMVLAQPER
SAA
NT seq 1272 nt NT seq  +upstreamnt  +downstreamnt
atgaccgcgcgacgagtcgtcatcaccggcgtcgaggtcctcgcccccggcggagtcggc
gcccggaagttctgggagttgctcaccgagggacgcaccgcgacccggggcatcaccttc
ttcgaccccagcccgttccgctctcgcgtggccgccgaggtcgacttcgacccgtacgcg
cacggcctgacccggcaggaggtccggcggatggaccgggccgcccagttcgcggtggtc
gccgcgcgcggcgccgtcaccgacagcggcctggccctcgacgctctcgacccctaccgg
atcggcgtcaccgtcggtaccgccgtcggctccaccatgagcctcgacgaggactaccgg
atggtcagtgacgacggccgcctcgatctggtcgaccacacctacgccgacccgtacttc
tacaactacttcgtaccgagctccttcgcggccgaggtcgcccgcgccgtcggcgcacag
ggaccgagcagcgtggtgtcggcgggctgcacctccggactcgactccgtgggctacgcc
gccgaactgatccgggagggcacggccgacgtcgtggtcaccggcgccaccgacgcgccg
atctccccgatcaccctcgcctgcttcgacgcgatcaaggcgaccacaccgcgcaacgac
gaaccggagcaggcctcccggcccttcgacggtacccgcaacgggttcgtgctcggcgag
ggcgccgcggcgttcgtcctggaggaactcgagagcgcgcgacgccggggtgcccgtatc
tacgcggagatcgcgggatacgcgacccggagcaacgcgtaccacatgacgggcctgcgc
gccgacggcgcggagatggccgaggcgatcaccgtcgccctcgacgaggcccggatgaac
cccacggacatcgactacatcaacgcgcacggctcggggaccaagcagaacgaccgtcac
gagaccgccgcgttcaagcgcagcctgggcgaccacgcgtaccgcaccccggtgagctcc
atcaagtccatggtggggcactcgctcggcgcgatcggctccatcgagatcgccgcatcg
atcctcgcgatccagcacaacgtggtgccgcccaccgcgaacctgcacacccccgacccc
gagtgcgacctggactacgtgccgctcacgtcccgcgaccagctcgtcgacgccgtcctc
acggtcggcagcggcttcggcgggttccagagcgcgatggtcctggcccagcccgaaagg
agcgcggcatga

DBGET integrated database retrieval system