KEGG   Streptococcus gallolyticus subsp. gallolyticus ATCC BAA-2069: SGGBAA2069_c08480Help
Entry
SGGBAA2069_c08480 CDS       T01444                                 

Gene name
acoC
Definition
(GenBank) pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase)
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
sgg  Streptococcus gallolyticus subsp. gallolyticus ATCC BAA-2069
Pathway
sgg00010  Glycolysis / Gluconeogenesis
sgg00020  Citrate cycle (TCA cycle)
sgg00620  Pyruvate metabolism
sgg01100  Metabolic pathways
sgg01110  Biosynthesis of secondary metabolites
sgg01120  Microbial metabolism in diverse environments
sgg01130  Biosynthesis of antibiotics
sgg01200  Carbon metabolism
Module
sgg_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:sgg00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SGGBAA2069_c08480 (acoC)
   00020 Citrate cycle (TCA cycle)
    SGGBAA2069_c08480 (acoC)
   00620 Pyruvate metabolism
    SGGBAA2069_c08480 (acoC)
Enzymes [BR:sgg01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     SGGBAA2069_c08480 (acoC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh E3_binding Biotin_lipoyl Biotin_lipoyl_2
Motif
Other DBs
NCBI-ProteinID: CBZ48020
LinkDB All DBs
Position
893368..894762
Genome map
AA seq 464 aa AA seqDB search
MANEIIMPKLGVDMQEGEILEWKKAEGDEVNEGDILLEIMSDKTNMEIEAEDSGVLLKIV
HPAGDVVAVTEVIGYIGAEGETLVDSVGEKHVEQSASAQEAKAQPLQASTAPAISQKTSE
TGKVRATPAARKLARERGIDLEKITGSGENGRIHKEDVEQFSKIRVTPLARRIAKDKGVD
LETLVGTGVSGKITKEDVLASLGDVAPQKEQADVKVTPQAGALADVTAASDGVEVIKMSA
MRKAISKGMSHSYFTAPTFTLNYDIDMTNLIALRKQLIEPIMAKTGYKVTFTDLIGLAVI
KTLMKEEHRFLNASLINDAQDIELHHFVNLAIAVGLSEGLVVPVVHGADQMSLSDFVVAS
KDVIQKAQDGKLKAAEMSGSTFTITNLGMFGVKSFNPIINQPNSAILGISATIETPVVHD
GEVVIRPIMGMSLTIDHRLVDGMNGAKFMLDLKALLENPLELLI
NT seq 1395 nt NT seq  +upstreamnt  +downstreamnt
gtggcaaatgaaattattatgccaaagcttggtgtggacatgcaagaaggggaaattctt
gaatggaaaaaagctgaaggtgatgaggtcaatgagggtgatattctgcttgaaatcatg
tctgataagaccaatatggaaatcgaagctgaagattctggcgtgctgttgaaaatcgtt
catccagcaggtgatgtcgtagctgttaccgaagttattggctatatcggagcagagggt
gaaactcttgttgattctgtgggtgagaaacatgttgaacagtcagcatcagctcaggaa
gcgaaagctcaaccgttgcaagcaagcacagcgccagcgatttcccaaaagacgtctgaa
actggaaaagtccgtgctacgcctgctgctagaaagttggcacgtgagcgtggtattgac
cttgaaaaaatcactggcagcggtgaaaatgggcggattcacaaggaagatgtggaacaa
tttagtaagattcgtgtgacgccactggctcgtaggattgcaaaggacaaaggtgttgac
cttgagacactggtgggaacgggtgtttctggtaagattaccaaggaagatgttttagca
agtctaggtgatgttgcgccgcaaaaagaacaagcagatgtaaaagtgacaccgcaagca
ggagctttggctgatgttacggctgcaagtgacggcgttgaagtcattaagatgtctgct
atgcgtaaggcaatttcaaagggaatgagccattcttactttacagcaccgacctttacg
cttaattatgatattgatatgacgaatctgattgccttgcgtaagcaactcattgagcca
attatggcaaagactggttacaaggtgacctttacggacttaattgggcttgctgtgatt
aagaccttgatgaaggaggaacaccgtttccttaatgcttctctgattaacgacgctcaa
gacatcgaactacatcattttgtcaatcttgcaatcgctgttgggctttctgaaggttta
gtggttcctgtggttcatggtgcagaccagatgagtttgtcagactttgtggtagcatca
aaagatgtgattcaaaaagcacaagatggtaaattgaaagcggctgaaatgtctggctca
acattcaccataacgaaccttgggatgtttggagtgaagtcgtttaatccgattattaat
caaccaaattcggcaattcttgggatttcagcaactattgaaacacccgtcgttcatgac
ggtgaagtggttattcgcccaattatggggatgagtttgaccattgatcaccgattggtt
gacggaatgaatggtgcaaaattcatgctagatttaaaagcgcttcttgaaaatccgcta
gaattgctaatctaa

DBGET integrated database retrieval system