KEGG   Streptococcus gallolyticus subsp. gallolyticus ATCC BAA-2069: SGGBAA2069_c10200Help
Entry
SGGBAA2069_c10200 CDS       T01444                                 

Gene name
amyA1
Definition
(GenBank) alpha-amylase
  KO
K01176  alpha-amylase [EC:3.2.1.1]
Organism
sgg  Streptococcus gallolyticus subsp. gallolyticus ATCC BAA-2069
Pathway
sgg00500  Starch and sucrose metabolism
sgg01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sgg00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    SGGBAA2069_c10200 (amyA1)
Enzymes [BR:sgg01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     SGGBAA2069_c10200 (amyA1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Alpha-amylase DUF1939 Glyco_hydro_70
Motif
Other DBs
NCBI-ProteinID: CBZ48192
LinkDB All DBs
Position
complement(1066388..1067842)
Genome map
AA seq 484 aa AA seqDB search
MTNETLMQYFEWYLPNDGKHWQRLAANAPELAQKGISKIWLPPAFKATHAGDVGYGVYDL
FDLGEFDQKGTIRTKYGTKADYLVAIASLKENGIEPLADVILNHKAAADHTETFTVVEVS
PEDRTEVLSEPFEIEGWTNFTFAGRHKTYNDFEWHWYHFTGTDYDVKTGKTGIFQIQGDN
KGWANQDLVDDENGNYDYLMYADLDFKHPEVIKNIYDWADWFVQTTGIAGFRLDAIKHID
SFFMGNFIRDMKLKYGDDFYVFGEFWNGDEQSNNDYLENTDYRFDLVDVRLHQNLFEASQ
EMEAYDLRTIFDQTLVKNHPDSAVTFVDNHDTQRGQALESTIAEWFKPAAYALILLRQTG
LPCIFYGDYYGISGEFAQENFKKEIDQLLQLRQTAVYGQEEDYFDDPNCIAWTCLGDDEH
PTALAILISNADAAPKRLFVGEKWANHIFTDALENNQTEVTIDAQGYGVFPVNEKSVSAW
VPNH
NT seq 1455 nt NT seq  +upstreamnt  +downstreamnt
atgacaaacgaaactttgatgcaatattttgaatggtatttaccaaatgacggaaaacat
tggcaacgattagcagctaatgctcccgaactagctcaaaaaggcatttctaaaatctgg
ttacctcctgcttttaaggctacacacgctggcgatgttggctatggtgtttatgacctt
ttcgacctcggagaatttgaccaaaaaggaacgattcggaccaaatatggaactaaagct
gattatcttgttgccattgctagcttaaaagaaaatggtattgagcccttagcggatgtg
attttgaatcacaaggcagcagctgaccacaccgaaacctttactgttgtcgaagtatcg
ccagaggaccgcacagaggttcttagtgaaccttttgaaatcgaaggttggacaaatttt
acctttgcaggtcggcataaaacctataatgattttgagtggcattggtatcattttaca
ggaacagattatgatgtcaaaactggaaaaactggaatttttcaaattcaaggcgacaat
aaaggttgggcaaatcaagatttagttgacgatgaaaatgggaattatgactatctgatg
tatgctgatttggatttcaaacaccctgaagtcattaaaaacatttacgattgggcagat
tggtttgttcaaacaactggtatcgctggttttcgattagacgctatcaaacacattgat
tctttcttcatgggcaattttatccgtgatatgaaattaaaatacggcgacgatttctac
gtctttggtgaattttggaatggtgatgaacagtctaacaacgattacttggaaaatacc
gattatcgttttgatttggtagatgtccgccttcatcaaaatctctttgaagctagccaa
gaaatggaggcttatgatttgcggacaatttttgaccaaaccttggtcaagaatcaccca
gattctgccgttacttttgtcgataaccatgacacacaacgtgggcaagctttggaatca
accattgcagaatggtttaagcctgctgcttacgctttgattctacttcgtcagactgga
ttgccttgcattttctatggtgattactacggtatttctggcgaatttgcacaagaaaat
ttcaaaaaagagattgaccaattgttgcaacttcgtcaaacagctgtctatggacaggaa
gaagattactttgatgacccaaattgcattgcgtggacttgtcttggggatgatgaacac
cccacagcactagctatactcatcagtaatgctgacgctgctccaaaacgtttatttgtt
ggcgagaaatgggctaaccacatttttacagacgccttagaaaataatcagaccgaggtc
accattgatgcgcaaggttatggcgtttttcctgttaatgaaaaatctgtcagcgcatgg
gtgccaaatcactaa

DBGET integrated database retrieval system