KEGG   Streptococcus gallolyticus subsp. gallolyticus ATCC BAA-2069: SGGBAA2069_c18300Help
Entry
SGGBAA2069_c18300 CDS       T01444                                 

Gene name
AlaT
Definition
(GenBank) aminotransferase
  KO
K14260  alanine-synthesizing transaminase [EC:2.6.1.66 2.6.1.2]
Organism
sgg  Streptococcus gallolyticus subsp. gallolyticus ATCC BAA-2069
Pathway
sgg00220  Arginine biosynthesis
sgg00250  Alanine, aspartate and glutamate metabolism
sgg00290  Valine, leucine and isoleucine biosynthesis
sgg01100  Metabolic pathways
sgg01110  Biosynthesis of secondary metabolites
sgg01130  Biosynthesis of antibiotics
sgg01210  2-Oxocarboxylic acid metabolism
sgg01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:sgg00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    SGGBAA2069_c18300 (AlaT)
   00290 Valine, leucine and isoleucine biosynthesis
    SGGBAA2069_c18300 (AlaT)
   00220 Arginine biosynthesis
    SGGBAA2069_c18300 (AlaT)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:sgg01007]
    SGGBAA2069_c18300 (AlaT)
Enzymes [BR:sgg01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.2  alanine transaminase
     SGGBAA2069_c18300 (AlaT)
    2.6.1.66  valine---pyruvate transaminase
     SGGBAA2069_c18300 (AlaT)
Amino acid related enzymes [BR:sgg01007]
 Aminotransferase (transaminase)
  Class I
   SGGBAA2069_c18300 (AlaT)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_1_2 DegT_DnrJ_EryC1 Aminotran_5 Beta_elim_lyase Alliinase_C Cys_Met_Meta_PP Aminotran_3
Motif
Other DBs
NCBI-ProteinID: CBZ49002
LinkDB All DBs
Position
complement(1884878..1886092)
Genome map
AA seq 404 aa AA seqDB search
MKIFDKSSKLEHVSYDIRGPILDEATRMIANGEKILRLNTGNPAEFGFTAPDEVIRDLIA
NARNSEAYSDSKGIFSARKAIMQYCQLKGFPHVDIDDIYLGNGVSELISMSLQALLDDGD
EVLVPMPDYPLWTACVSLAGGNAVHYLCDEKANWYPDIDDIKSKITSNTKAIVVINPNNP
TGALYPDELLKEIVEIARQNDLIIFADEIYDRLVMDGKKHTAIASLAPDVFCVSMNGLSK
SHRICGFRVGWMVLSGPKNNVKGYIEGLNMLANMRLCANVLGQHVVQTSLGGYQSVDELL
IPGGRIYEQRNFIYKAVNEVPGLSAVKPDAGLYIFPKIDREMYQIDDDEQFCLELLKQEK
VMLVPGKGFNWNEPDHFRIVYLPRVEELAEVQEKLTRVLNQYRR
NT seq 1215 nt NT seq  +upstreamnt  +downstreamnt
atgaaaatatttgataaatcttcaaagctagaacacgtttcttacgacatccgtggacca
attcttgacgaagccactcgtatgattgctaatggtgaaaaaatcttgcgccttaatact
ggtaacccagccgaatttggctttacagcaccagatgaagttatccgagatttgattgcc
aatgctcgcaatagtgaagcctattcagatagtaaagggattttttctgcgcgtaaggca
attatgcaatattgtcagctaaaaggattcccacatgtggatattgatgatatttatcta
ggaaatggtgtgtctgaattgatttcaatgtctcttcaggcgcttcttgatgatggcgat
gaagtcttggtgccaatgcctgactatccattgtggacagcttgtgttagcttggcgggc
ggtaatgctgttcattatctttgtgatgaaaaagctaactggtatcctgatattgatgat
atcaaatcaaaaatcacttctaacacaaaagcgattgttgtaattaaccctaataaccca
acaggcgctttataccctgatgagcttcttaaagaaattgttgaaattgctcgtcaaaat
gatttgattatctttgctgatgaaatctatgaccgcttggtaatggacggcaaaaaacac
acagcaattgctagcttagcaccagatgttttctgtgtgtcaatgaatggtttatcaaaa
tctcaccgaatctgcggtttccgtgttggttggatggtcttatcaggtcctaaaaataat
gttaaaggctacattgaaggacttaatatgttggcaaatatgcgtctttgcgccaatgtt
ttaggtcaacatgttgttcaaacatcacttggtggctaccaatcagttgatgaattgttg
attcctggtggtcgaatctatgaacaacgtaacttcatctacaaagctgttaatgaagtt
ccagggctttcagctgtgaaaccagacgcaggactttacattttccctaaaatcgaccgt
gaaatgtatcagattgatgatgacgaacaattctgtttggaattattgaaacaagaaaaa
gtcatgttggttccgggtaaaggattcaactggaatgagccagaccacttccgtatcgtt
tatctaccacgcgtggaagaattggcagaagttcaagaaaaattaacacgagtattaaat
caatatcgacgctaa

DBGET integrated database retrieval system