KEGG   Streptococcus gallolyticus subsp. gallolyticus ATCC BAA-2069: SGGBAA2069_p00020
Entry
SGGBAA2069_p00020 CDS       T01444                                 

Gene name
rep
Definition
(GenBank) putative replication protein rep
Organism
sgg  Streptococcus gallolyticus subsp. gallolyticus ATCC BAA-2069
SSDB
Motif
Pfam: Rep_3
Other DBs
NCBI-ProteinID: CBZ49483
LinkDB
Position
pSGG1:complement(2743..3573)
AA seq 276 aa
MNEIVRYNNDLNGLKMRKWTAEEMNFFFSVIAKVRDKGTRLVIFNSDELKELSGFANRHK
QRWEDVIDSVATKVADLKYYERTEQRILIMNLFAYFEADIINKTIEVEVSSKFEYVVNKL
LTNFTQYELEEFTNIRSTYAKTLYRLLKQWRTVGKKEFEINEFKEILDTPSSYRPSEIKR
LILNPTLKQLSPYFKDLKIKTIKSNKRGNPVLGYEFTWKPEKTGEWEDNKYKKNDFYKPK
KVESNVPNWVEKEYKHSATAEEQAKLEELRRSMFED
NT seq 831 nt   +upstreamnt  +downstreamnt
atgaacgaaatagtgcgatataataatgatttgaatggtttaaaaatgcgaaaatggact
gcagaagaaatgaattttttcttttctgtaatagcaaaagttagggataaaggaacacgc
ttagttattttcaattctgatgaactaaaggaactaagtggctttgctaatagacataaa
cagagatgggaagatgttattgatagtgtcgcaaccaaagtagcagatttaaagtattat
gaaagaacagaacaacgaatcttaatcatgaatttatttgcttattttgaagcagatatt
atcaataagacaatagaagttgaagtatcttcgaaatttgagtatgttgtcaataaatta
ctgacaaattttactcagtatgaacttgaagagtttactaatattcgttcaacttatgct
aaaactttgtatagattactcaaacagtggcggacagtagggaaaaaagaatttgaaatt
aatgaatttaaggaaattctagatactccgtcaagctatcgtccaagtgaaataaagaga
ttaatattaaatccaactctaaaacagctttctccgtattttaaggacttaaaaataaag
acaatcaaatcgaataaacgtggtaatccagttttgggatatgaatttacatggaaacca
gaaaaaacaggtgagtgggaagacaataaatacaagaaaaatgacttctataagcctaaa
aaagttgaatcgaatgtaccaaattgggtagaaaaagagtacaaacatagtgctacagca
gaagaacaagctaagttagaggaattaagacgtagcatgtttgaagactag

DBGET integrated database retrieval system