KEGG   Streptococcus gallolyticus subsp. gallolyticus ATCC BAA-2069: SGGBAA2069_p00030
Entry
SGGBAA2069_p00030 CDS       T01444                                 

Definition
(GenBank) putative secreted protein
Organism
sgg  Streptococcus gallolyticus subsp. gallolyticus ATCC BAA-2069
SSDB
Motif
Pfam: SpoIIIAH Mucin
Other DBs
NCBI-ProteinID: CBZ49484
LinkDB
Position
pSGG1:complement(4406..5251)
AA seq 281 aa
MVHKKLKIVIGAVLVLALGAGAFVIYQQANERETANRKQASNTFLQSGKTSSSSEETSST
ETEESTSSSVDTTQLTTDQVEEWVIASYINLKGLNVSPANFHVTVTASDDGLVYATLYGW
SLTDGEEITYRITADGTLEMFGLAEHKWITAETQYRAIGYYPNGIDIASVLDGDFSTLYG
TWVTSDGSYFTINNDNSVTFSQTSSTDITTLTVPDLNTELNSSIPYLGLQVNRPAAGAGL
FFLYPKGVTSHLGDSSDTTKDRIQAGFQPTPLTNDNVYYRQ
NT seq 846 nt   +upstreamnt  +downstreamnt
atggttcataaaaaacttaaaatcgttatcggtgcggtacttgttttagcactaggagca
ggagcttttgttatttaccaacaagcaaatgaacgtgaaacagctaatcgtaaacaagct
agtaatactttcttgcaatcaggtaaaacatctagctctagtgaggaaacttcctctacg
gaaacggaagaaagcactagctctagcgttgatacaacgcaacttacgacagaccaagta
gaagaatgggtaattgcttcctatatcaatttaaaaggacttaatgtttcaccagctaac
ttccacgtgacagtaacagcttctgatgatggtctagtctatgctacgctttatggctgg
tctttaacagatggtgaagaaatcacctatcgtattactgctgacggcacgttagaaatg
tttggacttgcggagcataaatggataacagctgaaacacaataccgagcaataggatat
tatccgaatggtattgatattgcaagtgtcctagacggcgacttttcaacgctttatggc
acgtgggtgacaagtgatggtagctacttcactattaataacgacaactcagttactttt
agtcaaacatcatcaactgatataacaacgttaactgtacctgatttaaatactgaatta
aatagctcaataccttatcttggtttacaagttaacagaccagcagcaggagcaggttta
tttttcttataccctaaaggagttactagtcaccttggcgatagttcagatacaacaaaa
gaccgtatccaagcaggttttcaaccgacacctttaacaaatgacaacgtttattatcgc
caataa

DBGET integrated database retrieval system