KEGG   Streptococcus gallolyticus subsp. gallolyticus ATCC BAA-2069: SGGBAA2069_p00050
Entry
SGGBAA2069_p00050 CDS       T01444                                 

Gene name
tnp(IS1216)
Definition
(GenBank) transposase for insertion sequence-like element IS1216
  KO
K07498  putative transposase
Organism
sgg  Streptococcus gallolyticus subsp. gallolyticus ATCC BAA-2069
Brite
KEGG Orthology (KO) [BR:sgg00001]
 09190 Not Included in Pathway or Brite
  09192 Unclassified: genetic information processing
   99976 Replication and repair
    SGGBAA2069_p00050 (tnp(IS1216))
SSDB
Motif
Pfam: DDE_Tnp_IS240 rve DDE_Tnp_IS66 DDE_3 HTH_32 HTH_21 HTH_23
Other DBs
NCBI-ProteinID: CBZ49486
LinkDB
Position
pSGG1:6606..7286
AA seq 226 aa
MNHFKGKQFQQDVIIVAVGYYLRYNLSYREVQEILYDRGINVSHTTIYRWVQEYGKLLYQ
IWKKKNKKSFYSWKMDETYIKIKGKWHYLYRAIDADGLTLDIWLRKKRDTQAAYAFLKRL
VKQFDEPKVVVTDKAPSITSAFKKLKEYGFYQGTEHRTIKYLNNLIEQDHRPVKRRNKFY
RSLRTASPTIKGMEAIRGLYKKTRKEGTLFGFSVCTEIKVLLGIPA
NT seq 681 nt   +upstreamnt  +downstreamnt
atgaatcattttaaaggaaagcaatttcagcaggatgtgattattgtagccgtgggctac
tatcttcgttataaccttagctatcgtgaagttcaagaaatcttatatgatcgtggcatt
aacgtttctcatacgacgatttatcgttgggtgcaagaatatggcaaactactctatcaa
atttggaaaaagaaaaataaaaaatccttttattcatggaaaatggatgaaacgtacatc
aaaattaaaggaaaatggcattatttgtatcgagccatcgatgcagatggtttaaccttg
gatatttggttacgtaaaaaacgggacacacaagcagcctatgcttttcttaagcggtta
gtgaagcagtttgatgaaccgaaggttgtagtcacagataaagccccctctattacaagt
gcctttaagaaactaaaagaatacggcttttatcaagggacagaacatcgtaccattaaa
tacctgaataatttgattgaacaagaccatcgtccagtaaagagacgcaataaattctat
cgaagtttacgcactgcctcacccacgattaaaggtatggaagccatccgaggattatat
aagaaaacccgaaaagaaggcactctcttcgggttttcggtctgtactgaaatcaaggta
ttattgggaatcccagcttaa

DBGET integrated database retrieval system