KEGG   Streptococcus gallolyticus subsp. gallolyticus ATCC BAA-2069: SGGBAA2069_p00060
Entry
SGGBAA2069_p00060 CDS       T01444                                 

Definition
(GenBank) omega transcriptional repressor
Organism
sgg  Streptococcus gallolyticus subsp. gallolyticus ATCC BAA-2069
SSDB
Motif
Pfam: Omega_Repress
Other DBs
NCBI-ProteinID: CBZ49487
LinkDB
Position
pSGG1:complement(7316..7522)
AA seq 68 aa
MIVGNLGAQKEKRNDTPISAKKDIMGDKTVRVRADLHHIIKIETAKNGGNVKEVMEIRLR
RVLLQSFK
NT seq 207 nt   +upstreamnt  +downstreamnt
gtgattgtgggaaatttaggcgcacaaaaagaaaaacgaaatgatacaccaatcagtgca
aaaaaagatataatgggagataagacggttcgtgttcgtgctgacttgcaccatatcata
aaaatcgaaacagcaaagaatggcggaaacgtaaaagaagttatggaaataagacttaga
agggttctgttgcaaagttttaaataa

DBGET integrated database retrieval system