KEGG   Streptococcus gallolyticus subsp. gallolyticus ATCC BAA-2069: SGGBAA2069_p00070
Entry
SGGBAA2069_p00070 CDS       T01444                                 

Definition
(GenBank) conserved hypothetical protein
Organism
sgg  Streptococcus gallolyticus subsp. gallolyticus ATCC BAA-2069
SSDB
Motif
Pfam: TnpV
Other DBs
NCBI-ProteinID: CBZ49488
LinkDB
Position
pSGG1:7681..7998
AA seq 105 aa
MIPCLTVPAEEEQAIGIWGQRHLDYLKQYRKVTYTNLLTSGRLNAYLADINRQAQERFER
LIEGMKQAQGITEQLKAENALEWTGCLNNIRACAREIVEKEIIFA
NT seq 318 nt   +upstreamnt  +downstreamnt
ttgataccgtgcttaactgtacccgccgaagaagaacaggcaataggcatctgggggcaa
cggcatttagattatctaaaacagtaccgtaaagttacatacaccaatcttcttacaagc
ggcaggctaaacgcctaccttgccgacatcaacagacaggcacaggaacgctttgaaagg
ctcatagagggtatgaaacaggcacagggcataacggaacagctaaaggcagaaaacgcc
ttagaatggacaggatgcctcaataacataagggcttgtgcgagggagattgtggaaaag
gaaattatttttgcataa

DBGET integrated database retrieval system