KEGG   Streptococcus gallolyticus subsp. gallolyticus ATCC BAA-2069: SGGBAA2069_p00080
Entry
SGGBAA2069_p00080 CDS       T01444                                 

Gene name
tet(O_W_32_O)
Definition
(GenBank) putative tetracycline resistance protein tet(O/W/32/O)
  KO
K18220  ribosomal protection tetracycline resistance protein
Organism
sgg  Streptococcus gallolyticus subsp. gallolyticus ATCC BAA-2069
Brite
KEGG Orthology (KO) [BR:sgg00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   01504 Antimicrobial resistance genes [BR:sgg01504]
    SGGBAA2069_p00080 (tet(O_W_32_O))
Antimicrobial resistance genes [BR:sgg01504]
 Gene variants
  Tetracycline resistance genes
   Others
    SGGBAA2069_p00080 (tet(O_W_32_O))
SSDB
Motif
Pfam: GTP_EFTU EFG_IV EFG_C EFG_III MMR_HSR1 FeoB_N RF3_C Septin AIG1 cobW GTP_EFTU_D2 PMC2NT
Other DBs
NCBI-ProteinID: CBZ49489
LinkDB
Position
pSGG1:8365..10284
AA seq 639 aa
MKIINLGILAHVDAGKTTLTESLLYTSGAIAELGSVDEGTTRTDTMNLERQRGITIQTAV
TSFQWEDVKVNIIDTPGHMDFLAEVYRSLAVLDGAILVISAKDGVQAQTRILFHALRKMN
IPTVIFINKIDQAGVDLQSVVQSVRDKLSADIIIKQTVSLSPEIVLEENTDIEAWDAVIE
NNDKLLEKYIAGEPISREKLVREEQRRVQDASLFPVYYGSAKKGLGIQPLMDAVTGLFQP
IGEQGSAALCGSVFKVEYTDCGQRRVYLRLYSGTLRLRDTVALAGREKLKITEMRIPSKG
EIVRTDTAYPGEIVILADDTLKLNDILGNEKLLPHKTRIDNPMPLLRTTVEPQKPEQREA
LLNALAEIADTDPLLHFDIDTVTHEIMLSFLGKVQLEVICSLLEEKYHVGVAMKEPSVIY
LERPLRKAEYTIHIEVPPNPFWASVGLSIEPLPIGSGVQYESRVSLGYLNQSFQNAVMEG
VLYGCEQGLYGWKVTDCKICFEYGLYYSPVSTPADFRLLSPIVLEQALKKAGTELLEPYL
HFEIYAPQEYLSRAYHDAPRYCADIVSTQIKNDEVILKGEIPARCIQEYRNDLTNFTNGQ
GVCLTELKGYQPAIGKFICQPRRPNSRIDKVRHMFHKLA
NT seq 1920 nt   +upstreamnt  +downstreamnt
atgaaaataattaacttaggcattctggctcacgttgacgcaggaaagacaacattaacg
gaaagtttattgtataccagtggtgcaattgcagaactagggagcgtagatgaaggcaca
acaaggacagatacaatgaatttggagcgtcaaaggggaatcactatccagacagcagtg
acatcttttcagtgggaggatgtaaaagtcaacattatagatacgccaggccatatggat
tttttggcggaggtgtaccgctctttggctgttttagatggggccatcttggtgatctcc
gctaaagatggcgtgcaggcccagacccgtattctgttccatgccctgcggaaaatgaac
attcccaccgttatctttatcaacaagatcgaccaggctggcgttgatttgcagagcgtg
gttcagtctgttcgggataagctctccgccgatattatcatcaagcagacggtgtcgctg
tccccggaaatagtcctggaggaaaataccgacatagaagcatgggatgcggtcatcgaa
aataacgataaattattggaaaagtatatcgcaggagaaccaatcagccgggaaaaactt
gtgcgggaggaacagcggcgggttcaagacgcctccctgttcccggtctattatggcagc
gccaaaaagggccttggcattcaaccgttgatggatgcggtgacagggctgttccaaccg
attggggaacaggggagcgccgccctatgcggcagcgttttcaaggtggagtatacagat
tgcggccagcggcgtgtctatctacggctatacagcggaacgctgcgcctgcgggatacg
gtggccctggccgggagagaaaagctgaaaatcacagagatgcgtattccatccaaaggg
gaaattgttcggacagacaccgcttatccgggagaaattgttattttagctgatgatact
ttgaaactgaacgacattctaggaaatgaaaaactcctgcctcataaaacacggattgat
aatcccatgccattacttcggacaacggtagagccgcaaaagccggagcaaagggaagcc
ctgttaaatgccctcgcagagattgctgatacagaccctcttttgcattttgacattgat
actgttacacatgagattatgttatcttttttgggaaaagtacagttagaagttatttgt
tcgctattagaagaaaaatatcatgtgggcgtggctatgaaagagccttcggttatttat
ctggaaagaccgcttagaaaagcagaatataccatccacatagaagtcccgccaaatcct
ttctgggcttctgtcgggttgtccatagagccgctccctattggaagcggagtgcagtat
gaaagcagagtttcacttggatatttaaatcaatcgttccaaaatgcggttatggagggg
gttctttatggctgcgagcaggggctgtatggatggaaagtgacagactgtaaaatctgt
tttgaatatggattgtattatagtcctgtaagtacccccgcagactttcggctgctttcc
cctatcgtattggagcaggctttaaaaaaagcagggacagaactattagagccatatctc
cactttgaaatttatgcaccgcaggaatatctctcacgggcgtatcatgatgctccaagg
tattgtgcagatattgtaagtactcagataaagaatgacgaggtcattctgaaaggagaa
atccctgctagatgtattcaagaatacaggaacgatttaactaatttcacaaatgggcag
ggagtctgcttgacagagttaaaaggataccagccagctattggtaaatttatttgccaa
ccccgccgcccgaatagccgtatagataaggttcggcatatgttccacaagttagcttaa

DBGET integrated database retrieval system