KEGG   Streptococcus gallolyticus subsp. gallolyticus ATCC BAA-2069: SGGBAA2069_p00090
Entry
SGGBAA2069_p00090 CDS       T01444                                 

Definition
(GenBank) putative relaxase or endonuclease
Organism
sgg  Streptococcus gallolyticus subsp. gallolyticus ATCC BAA-2069
SSDB
Motif
Pfam: Relaxase DUF5442
Other DBs
NCBI-ProteinID: CBZ49490
LinkDB
Position
pSGG1:10707..11219
AA seq 170 aa
MHVPEKGKTFAGEVREETVAWSKDTYQLLKQAEQGKVKSYVQDIALAVLDCKETATSRET
FIRLMNERGYGVDWQDSHKYITYTDLAREQAGEKACKIRDNKLEKYYNMDFGKESMEHEF
ERNARTAEAEQSKRAASRVKPTEPDRAGKQSAQRSVGDVELAEHTSAVNG
NT seq 513 nt   +upstreamnt  +downstreamnt
ttgcatgtgccggagaaaggaaagacatttgctggagaagtccgggaagaaacggtggca
tggagcaaagacacctaccagcttttgaaacaggcagagcagggaaaggtcaaaagctat
gtgcaggatattgcccttgcggtgctggattgtaaggaaacagcgaccagccgggaaacc
tttatccggctgatgaatgaaagagggtacggggtggactggcaggacagccacaagtac
atcacatataccgacttagccagggaacaggcaggagaaaaggcttgtaaaatcagggat
aacaagctggaaaaatactacaatatggattttggaaaggagagtatggagcatgagttt
gagagaaatgcacgaacagcagaagcagagcagtccaagagagcagcttcaagagttaaa
ccgacagagccggacagagctggaaaacagtctgctcaaagaagcgttggcgatgtcgag
ctggcagagcatacaagtgctgttaatggttaa

DBGET integrated database retrieval system