KEGG   Streptococcus gallolyticus subsp. gallolyticus ATCC BAA-2069: SGGBAA2069_p00100
Entry
SGGBAA2069_p00100 CDS       T01444                                 

Definition
(GenBank) replication protein
Organism
sgg  Streptococcus gallolyticus subsp. gallolyticus ATCC BAA-2069
SSDB
Motif
Pfam: Rep_1 FRG1 Vasohibin
Other DBs
NCBI-ProteinID: CBZ49491
LinkDB
Position
pSGG1:11059..11658
AA seq 199 aa
MSLREMHEQQKQSSPREQLQELNRQSRTELENSLLKEALAMSSWQSIQVLLMVKASYFGG
DYYISQDEWTSMWQQSAKLDYKPIVDVRKVKPNQRKAKSDMDLRGAIVETAKYPTKPIEK
MGKTEEQKLKVTDDLMKALKNKRQIGFGGLFKEIRKELQLDDVERGDLIHIDDENQDVSM
GVEIVAIWNWERKNYFIKE
NT seq 600 nt   +upstreamnt  +downstreamnt
atgagtttgagagaaatgcacgaacagcagaagcagagcagtccaagagagcagcttcaa
gagttaaaccgacagagccggacagagctggaaaacagtctgctcaaagaagcgttggcg
atgtcgagctggcagagcatacaagtgctgttaatggttaaagcgtcgtattttggtggc
gattattatatctcgcaagatgaatggacgagtatgtggcaacaatcggcaaagcttgat
tacaagccaattgtagacgtgcgaaaagtaaaaccaaatcagcgtaaagctaagagtgac
atggatttgcgtggtgcaattgtcgaaacagcgaagtatccaaccaagccgatagagaaa
atgggcaaaacggaagaacaaaaactgaaagtgactgatgatttgatgaaagccttgaaa
aacaagcgtcaaattgggtttggtggtttgtttaaagagatacgcaaagagttgcagttg
gatgatgttgagagaggtgatctcattcacatcgatgatgaaaatcaggacgtaagtatg
ggcgtggaaattgtcgcaatctggaattgggaacggaaaaattattttattaaagagtag

DBGET integrated database retrieval system