KEGG   Streptococcus gallolyticus subsp. gallolyticus ATCC BAA-2069: SGGBAA2069_p00110
Entry
SGGBAA2069_p00110 CDS       T01444                                 

Gene name
tetL
Definition
(GenBank) tetracycline resistance protein TetL
  KO
K08168  MFS transporter, DHA2 family, metal-tetracycline-proton antiporter
Organism
sgg  Streptococcus gallolyticus subsp. gallolyticus ATCC BAA-2069
Brite
KEGG Orthology (KO) [BR:sgg00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:sgg02000]
    SGGBAA2069_p00110 (tetL)
   01504 Antimicrobial resistance genes [BR:sgg01504]
    SGGBAA2069_p00110 (tetL)
Transporters [BR:sgg02000]
 Major facilitator superfamily (MFS)
  Drug transporters
   Drug:H+ antiporter-2 (14 spanner) (DHA2) family [TC:2.A.1.3]
    SGGBAA2069_p00110 (tetL)
Antimicrobial resistance genes [BR:sgg01504]
 Gene variants
  Tetracycline resistance genes
   Transporters
    SGGBAA2069_p00110 (tetL)
 Gene sets
  Vancomycin resistance modules
   Tetracycline resistance, efflux pump Tet38 [MD:M00704]
    SGGBAA2069_p00110 (tetL)
SSDB
Motif
Pfam: MFS_1 Tet_res_leader Sugar_tr MFS_3
Other DBs
NCBI-ProteinID: CBZ49492
LinkDB
Position
pSGG1:11762..13165
AA seq 467 aa
MKCNECNRVQLKEGSVSFLRHNQILIWLCILSFFSVLNEMVLNVSLPDIANDFNKSPAST
SWVNTAFMLTFSIGTALYGKLSDQLGIKRLLLFGIIINCFGSVIGFVGHSFFPILILARF
IQGAGAAAFPALVMVVVARYIPKENRGKAFGLIGSIVAMGEGIGPAIGGMIAHYIHWSYL
LLIPMITIITVPFLMKLLKKEVRIKGHFDIKGIILMSVGIVFFMLFTTSYSISFLIVSVL
SFLIFVKHIRKVTDPFVDPGLGKNIPFMIGVLCGGIIFGTVAGFVSMVPYMMKDVHQLST
AEIGSVIIFPGTMSVIIFGYIGGILVDRRGPLYVLNIGFTFLSVSFLTASFLLETTSWFM
TIIIVFVLGGLSFTKTVISTIVSSSLKQQEAGAGMSLLNFTSFLSEGTGIAIVGGLLSIP
LLDQRLLPMEVDQSTYLYSNLLLLFSGIIVISWLVTLNVYKHSQRDF
NT seq 1404 nt   +upstreamnt  +downstreamnt
atgaagtgtaatgaatgtaacagggttcaattaaaagagggaagcgtatcatttttacga
cacaaccaaattttaatttggctttgcattttatctttttttagcgtattaaatgaaatg
gttttgaacgtctcattacctgatattgcaaatgattttaataaatcaccggcgagtaca
agctgggtgaacacagcctttatgttaaccttttctattggaacagctctatatggaaag
ctatctgatcagctaggcattaaaaggttactcctatttgggattataataaattgcttc
ggatcggtaattgggtttgttggacattctttttttcccatacttattctggctcgattt
attcaaggagctggtgcagctgcatttccagcactcgtgatggttgtagttgcgcgctat
attccaaaggaaaataggggtaaagcgtttggtcttattggctccatagtagctatggga
gaaggtatcggtccagctattggtggaatgatagcccattatattcattggtcctatctt
ctactcattcctatgataacaattatcactgttccgtttcttatgaaattattaaagaaa
gaagtaaggataaaaggtcattttgatatcaaaggaattatactaatgtctgtaggcatt
gtattttttatgttgtttacaacatcatatagcatttcttttcttatcgttagcgtgctg
tcattcctgatatttgtaaaacatatcaggaaagtaacagatccttttgttgatcccgga
ttagggaaaaatataccttttatgattggagttctttgtgggggaattatatttggaaca
gtagcagggtttgtctctatggttccttatatgatgaaagatgttcaccagctaagtact
gccgaaatcggaagtgtaattattttccctggaacaatgagtgtcattattttcggctac
attggtgggatacttgttgatagaagaggtcctttatacgtgttaaacatcggatttaca
tttctttctgttagctttttaactgcttcctttcttttagaaacaacatcatggttcatg
acaattataatcgtatttgttttaggtgggctttcgttcaccaaaacagttatatcaaca
attgtttcaagtagcttgaaacagcaggaagctggtgctggaatgagtttgcttaacttt
accagctttttatcagagggaacaggtattgcaattgtaggtggtttattatccataccc
ttacttgatcaaaggttgttacctatggaagttgatcagtcaacttatctgtatagtaat
ttgttattacttttttcaggaatcattgtcattagttggctggttaccttgaatgtatat
aaacattctcaaagggatttctaa

DBGET integrated database retrieval system