KEGG   Streptococcus gallolyticus subsp. gallolyticus ATCC BAA-2069: SGGBAA2069_p00120
Entry
SGGBAA2069_p00120 CDS       T01444                                 

Definition
(GenBank) hypothetical protein
Organism
sgg  Streptococcus gallolyticus subsp. gallolyticus ATCC BAA-2069
SSDB
Other DBs
NCBI-ProteinID: CBZ49494
LinkDB
Position
pSGG1:complement(13214..13414)
AA seq 66 aa
MPIFILSVLSSLPKARLSKNKIFIVFRFSSVTDKTTQNKKDTREVSRIFYSAIAPFNGTK
RFEFLL
NT seq 201 nt   +upstreamnt  +downstreamnt
ttgccaatttttattttgtccgttttgtctagcttaccgaaagccagactcagcaagaat
aaaatttttattgtctttcggttttctagtgtaacggacaaaaccactcaaaataaaaaa
gatacaagagaggtctctcgtatcttttattcagcaatcgcgccctttaatggaacaaaa
agatttgaattcctgttataa

DBGET integrated database retrieval system