KEGG   Streptococcus gallolyticus subsp. gallolyticus ATCC BAA-2069: SGGBAA2069_p00140
Entry
SGGBAA2069_p00140 CDS       T01444                                 

Gene name
repA
Definition
(GenBank) putative replication protein rep
Organism
sgg  Streptococcus gallolyticus subsp. gallolyticus ATCC BAA-2069
SSDB
Motif
Pfam: Rep_3
Other DBs
NCBI-ProteinID: CBZ49495
LinkDB
Position
pSGG1:complement(13755..14630)
AA seq 291 aa
MFSVIIKTKNNRGSHMNEIVRYNNDLNGLKMRKWTAEEMNFFFSVIAKVRDKGTRSVTFN
SDDLKELSNFADRHQQRWEEVIDGVANKVANLKYYERTEKRILIMNLFAYFEADIISKTI
EVEVSSKFEYVVNKLLTNFTQYELEEFTNIRSTYAKTLYRLLKQWRTVGKKEFEINEFKE
ILDTPTSYRPSEINRLILNPTLKQLSPYFKDLKIKTIKSNKRGNPVLGYEFTWKPEKTGE
WEEDKYKKNDFYKSKNSTSNVPDWVEKEYKHSATAEEQAKLEELRRRMSED
NT seq 876 nt   +upstreamnt  +downstreamnt
atgttttctgttattataaagacaaaaaataatagaggttcccatatgaatgaaatagtc
cgatacaataatgatttaaatggtttaaaaatgcgaaaatggacagcagaggaaatgaat
tttttcttttctgtaatagcaaaagttagagataagggaacacgttcagttacctttaat
tctgatgatttaaaggaattaagtaattttgctgacagacatcagcaacgttgggaagag
gttatcgatggtgtcgcaaataaagtagctaatttgaaatattatgaaagaacagaaaaa
cgaattttaatcatgaatttatttgcttattttgaagcagatattatcagtaaaacaata
gaagttgaagtatcttcgaaatttgagtatgttgtcaataaattactgacaaattttact
cagtatgaacttgaagagtttaccaatattcgttcgacttatgctaaaactttgtataga
ttacttaaacagtggcgaacagtgggaaaaaaagaatttgaaattaatgaattcaaagaa
attctggatactccaacaagctatcgtccaagtgaaataaatagattaatattaaatcca
acccttaagcagctttctccgtattttaaagacttaaaaataaagacaatcaagtcaaat
aaacgtggtaaccctgttttaggttatgaatttacatggaaaccagaaaaaacaggtgag
tgggaagaggataaatacaagaaaaatgacttctacaagtctaaaaatagcacatcaaat
gtaccagattgggtagaaaaagaatacaagcatagtgctacagcggaagaacaggctaaa
cttgaagaattaagacgtagaatgtctgaagattga

DBGET integrated database retrieval system