KEGG   Streptococcus gallolyticus subsp. gallolyticus ATCC BAA-2069: SGGBAA2069_p00150
Entry
SGGBAA2069_p00150 CDS       T01444                                 

Gene name
resP
Definition
(GenBank) resolvase / invertase
Organism
sgg  Streptococcus gallolyticus subsp. gallolyticus ATCC BAA-2069
SSDB
Motif
Pfam: Resolvase HTH_23 HTH_7 HTH_49 Spc7 HTH_29
Other DBs
NCBI-ProteinID: CBZ49496
LinkDB
Position
pSGG1:complement(15474..16058)
AA seq 194 aa
MAKIGYARVSTSGQNLDRQLEQLQDVDKIFQEAISGVSKDRPQLQAMLEYIREGDIVIVT
ELSRLGRNNKELTEIMNSIQAKGATLDVLNLPTLRGIDDNNLRHLLNNLILELYKYQVQS
ERERIKERQAQGIAIAKAKGKYKGRKPLFSEADDKLQHAFQLFQEGHSDKDVERLTGINE
RTFRRYRSRYGIEK
NT seq 585 nt   +upstreamnt  +downstreamnt
atggcaaaaatcggctatgcacgggtcagtacatctggccaaaatttggatagacaacta
gagcagctccaagatgttgacaaaatattccaggaagctatcagcggcgtaagcaaagac
cgaccacaactgcaagcaatgttagagtatatccgtgaaggggatattgtcatcgtgacg
gagctctcacgactaggacggaacaacaaagaactaaccgagatcatgaactccattcaa
gccaaaggagccactttagacgtgctcaaccttccaacccttcgagggattgacgataac
aatctcagacacttgcttaacaaccttattctggaactctataaataccaagtacaatca
gaaagggagcgaataaaggagcgtcaggcgcaaggcattgctattgccaaagccaaaggc
aagtataaaggtcggaaaccgctcttttcagaggctgatgacaaactccaacatgctttc
caactgttccaagaaggacattcagataaagatgtcgaacgactaacagggattaacgag
cgtacctttagacgatatcgtagcaggtatgggattgaaaaataa

DBGET integrated database retrieval system