KEGG   Streptococcus gallolyticus subsp. gallolyticus ATCC BAA-2069: SGGBAA2069_p00160
Entry
SGGBAA2069_p00160 CDS       T01444                                 

Definition
(GenBank) hypothetical protein
Organism
sgg  Streptococcus gallolyticus subsp. gallolyticus ATCC BAA-2069
SSDB
Other DBs
NCBI-ProteinID: CBZ49497
LinkDB
Position
pSGG1:complement(16315..16461)
AA seq 48 aa
MELTDNLNKELTFDEVDTDEFYGDGWFIGGAIAGAVVGGAIWAGVTLT
NT seq 147 nt   +upstreamnt  +downstreamnt
atggaattaacagataaccttaataaggaattgacttttgacgaagtagatacagatgaa
ttttatggtgatggctggtttatcggtggtgccattgctggagctgtagttggtggagct
atttgggctggtgttactttgacctaa

DBGET integrated database retrieval system