KEGG   Streptococcus gallolyticus subsp. gallolyticus ATCC BAA-2069: SGGBAA2069_p00170
Entry
SGGBAA2069_p00170 CDS       T01444                                 

Definition
(GenBank) hypothetical protein
Organism
sgg  Streptococcus gallolyticus subsp. gallolyticus ATCC BAA-2069
SSDB
Motif
Pfam: Gemin7
Other DBs
NCBI-ProteinID: CBZ49498
LinkDB
Position
pSGG1:complement(17351..17473)
AA seq 40 aa
MKGGEIMEKRQITFEEVAVDELSTDLGKLLLQALLRPIIL
NT seq 123 nt   +upstreamnt  +downstreamnt
ttgaaggggggtgagataatggaaaaaagacaaattacttttgaagaagttgcagttgac
gaattaagtactgacttgggaaaactattacttcaggcgctactccgcccaatcattctt
taa

DBGET integrated database retrieval system