KEGG   Streptococcus gallolyticus subsp. gallolyticus ATCC BAA-2069: SGGBAA2069_p00200
Entry
SGGBAA2069_p00200 CDS       T01444                                 

Gene name
mob
Definition
(GenBank) putative mobilization protein
Organism
sgg  Streptococcus gallolyticus subsp. gallolyticus ATCC BAA-2069
SSDB
Motif
Pfam: Phage_holin_3_6 E1-E2_ATPase T2SSF HTH_23 LMBR1 Hydin_ADK
Other DBs
NCBI-ProteinID: CBZ49501
LinkDB
Position
pSGG1:complement(18659..19213)
AA seq 184 aa
MGKTVAELSQEFGVTPQYLNRILKENKIGNKIGNKNIVSETEEVLLKTIIERKSKKKSET
KTETKSETSFVFVSERQLLQKDKEIDKLHQLLDQAQQLLLNEQKKNQLLLESKSENDLSD
WKEEKNRLESQVQLLQETSQLARQEVNQKQAKLERNSRLLSILAAVILVFFLLLLFLVWL
YLNK
NT seq 555 nt   +upstreamnt  +downstreamnt
atgggtaaaacagtggcagaactatctcaagagtttggtgttactcctcaatacttgaac
cgtattttaaaagaaaacaaaatcggaaacaaaatcggaaacaaaaatatagtttctgaa
accgaagaggtattattaaaaacgataattgagcgaaaatctaagaaaaaatcggaaact
aaaacagaaacaaaatcggaaacgagtttcgtttttgtttctgaaagacaactgcttcaa
aaagataaagaaatagataaacttcaccaattattggaccaagcacaacaacttttacta
aatgaacaaaagaaaaatcaacttttactagaatcaaagagtgaaaatgacttaagcgat
tggaaagaagaaaaaaataggctagagagccaagtacagcttctacaagagacatctcaa
ttagctagacaagaagtgaatcaaaagcaagctaaattagaacgaaatagtcgcctgctc
agtattttagcagccgtaattcttgtattttttcttttgttgctgtttctagtttggctt
tatctaaacaaataa

DBGET integrated database retrieval system