KEGG   Streptococcus gallolyticus subsp. gallolyticus ATCC BAA-2069: SGGBAA2069_p00210
Entry
SGGBAA2069_p00210 CDS       T01444                                 

Gene name
rep1
Definition
(GenBank) replication protein
Organism
sgg  Streptococcus gallolyticus subsp. gallolyticus ATCC BAA-2069
SSDB
Motif
Pfam: Rep_3
Other DBs
NCBI-ProteinID: CBZ49502
LinkDB
Position
pSGG1:complement(19471..20412)
AA seq 313 aa
MPPYGCRNATLLRNKFIFCFIIFFVLLLRNIKGVFFMSNEIVKYHNDLNTIPMRKWTAEE
MNFFFAILAKAKNKGTQLLVFDTDELKKLSGFSDKHSQRWESTVTAVSKKVLGIQYIERT
ETHLMVANLFSHFEIDLVNRTLEVGLSPKFEYIVNKLEANFTQYELEEFTTIRSTYAKTA
YRLLKQWRTIGKKEFPIGEFKNLMDMPRSYKSSEIDRAVIKPILKELSQYFIGLKVKKIK
SNKRGNPVLGYEFTWKPEKTGNWEDDKYKKNDFYKPKKNVSNVPDWVEKEYKHSATAEEQ
AKLEELRRSMLEE
NT seq 942 nt   +upstreamnt  +downstreamnt
atgccaccttatgggtgtagaaatgccaccttattaagaaataaattcattttttgcttt
ataatcttttttgtgttattattaagaaatataaaaggagtgttctttatgagtaatgaa
attgttaaataccataatgacttgaatactattcccatgaggaaatggacagctgaagaa
atgaattttttctttgcaatcttagctaaagctaagaataaaggaacacaattactggtt
tttgatacagatgaattaaaaaaattaagtggtttttctgataagcactctcaaagatgg
gaaagtacggtaactgctgtttcaaaaaaagttttagggattcaatatattgaacgtacg
gaaacacatttgatggttgcaaatcttttttcacattttgaaatagatttagtaaatcgt
actctagaagttggtctttcacctaaatttgaatatatagttaataaacttgaagccaat
ttcactcagtatgagcttgaagagtttaccactattcggtcaacttatgctaaaactgct
tatcgtttgttaaaacaatggcgcacaattggcaaaaaagaatttccaatcggagaattt
aaaaacctaatggatatgccaagaagttataaatcaagtgagattgatagagctgtaatt
aaacccattttgaaagaattgagtcagtattttattggcttaaaagttaaaaaaatcaag
tcaaataagcgtggtaaccctgtcttaggttatgaatttacatggaaaccagaaaaaaca
ggaaattgggaagacgataaatacaagaaaaatgacttctacaaacctaaaaagaatgtc
tcaaatgtaccagattgggtagaaaaagagtacaaacatagtgcaacagctgaagaacag
gcaaaacttgaagaattgagacgtagtatgcttgaagaatag

DBGET integrated database retrieval system