KEGG   Sinocyclocheilus grahami: 107548615Help
Entry
107548615         CDS       T04918                                 

Definition
(RefSeq) PR domain zinc finger protein 8-like
  KO
K20797  PR domain zinc finger protein 8 [EC:2.1.1.-]
Organism
sgh  Sinocyclocheilus grahami
Brite
KEGG Orthology (KO) [BR:sgh00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:sgh03036]
    107548615
Enzymes [BR:sgh01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.-  
     107548615
Chromosome and associated proteins [BR:sgh03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     107548615
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: zf-C2H2_4 zf-C2H2 zf-H2C2_2 GAGA DUF2072 zf-C2H2_9 Zn-C2H2_12
Motif
Other DBs
NCBI-GeneID: 107548615
NCBI-ProteinID: XP_016084858
LinkDB All DBs
Position
Unknown
AA seq 501 aa AA seqDB search
MEQSIFPRSLWTNDSKFLHHHVADFFTSVQVTQDIPAGTSFGPCVLHNTFYDTIAFIALK
SSDKRNKSYVFRVDPEAMKGSPLVVPWLRLVQAAMSTEDQNTEAYLKGGQLHFQTIRDVK
QADELLVWYDEELSHLLGFEDIKTKALTDGYTCTRCGQAFKNENPFLAHCRFLCVQEKVD
IIRPTNEQKQEVKRQRKIIDFHNIARDLEHKKNGSPEDMGIPRKRKQEGSLSPRRKKTVL
LEKINITNYSNTANVNTDGPPFQDLSESDNLSTNKPKRSKSSAFTVVRKPSEQSNPEQTS
RDVTTSEVGLQSDCSAFSFVVPKSAHSEQKSAFCEPNKRTITEVQNPSPPDSDNISDSFK
LKPALGYRNVLASHLFHADLPSAHAGGVMSAPLATGGSFYYYAPEHWTRAIGGQLQSTSS
LTLLPPTFTPRGVSVQNWCAKCNLSFRMTSDLVFHMRSHHKKEFATEALVRRRREEKLTC
PICHEYFRERHHLSRHMTSHN
NT seq 1506 nt NT seq  +upstreamnt  +downstreamnt
atggaacagagtattttccctcgctccttgtggactaatgacagcaaatttctccatcac
catgtcgcggatttcttcaccagtgtacaagttacacaggatatacctgctggaacatca
ttcggaccttgtgttcttcataataccttttatgacactatagccttcattgcattgaag
tcctctgacaaacggaataaatcctatgtatttcgggtagatcccgaggcgatgaaaggt
tctccattagtagttccttggctgcggttagtacaggctgcaatgagcacagaagaccag
aatactgaggcctacttgaaaggaggacagctgcactttcagactattcgagatgtgaag
caagcggatgaactgcttgtttggtatgatgaggagttgtcacatcttttggggttcgaa
gatataaagacaaaagccctgacagatggctatacatgtacgagatgcggccaggccttc
aaaaacgaaaaccctttccttgcccactgtcgttttttatgtgtgcaggaaaaagtagat
attattcgaccaaccaacgaacagaaacaagaagtcaagcgacagcgcaaaatcatagat
tttcacaacattgcaagagatctggagcacaaaaagaacggttctcctgaagacatgggc
atacctaggaaaagaaaacaagaaggttccttaagtccccggagaaaaaaaactgtgtta
ttggagaaaatcaacatcactaattacagcaacaccgccaacgtcaacacagatggtcca
ccttttcaggatttgtcagaatcagacaatttatcaacaaataagccaaagagaagtaaa
agcagcgcatttaccgtggttagaaaaccatcagagcagtcaaaccccgagcagacatca
cgggatgtaacgacgtctgaagtaggcctgcaatccgactgcagcgcgttctcatttgtt
gtgcctaagagtgcgcactcagaacagaagagcgcgttctgtgaacccaacaaacgcacc
atcaccgaagttcagaatccttcaccaccagattcggataatatctcagactctttcaaa
ttaaaacctgcactaggatacagaaatgtattggcgtcgcacctgtttcacgctgacttg
ccaagcgctcatgcaggtggagtgatgtccgctcctctggctacaggaggatccttttat
tattatgcgcctgagcattggaccagagctataggtggccagctacagtctacttcttct
ttgacacttttgccccctactttcacaccacggggtgtttcagtgcagaactggtgcgcc
aaatgcaatctctcattccgaatgacctccgacttggtgtttcacatgcggtcacatcat
aagaaagagttcgccacagaggctctggtgaggcggaggagagaggagaaactcacctgt
cccatctgtcacgagtactttcgagagcgtcaccacctctcacgtcacatgacatcacat
aattaa

DBGET integrated database retrieval system