KEGG   Sinocyclocheilus grahami: 107548633
Entry
107548633         CDS       T04918                                 

Definition
(RefSeq) mitogen-activated protein kinase 8B isoform X1
  KO
K04440  mitogen-activated protein kinase 8/9/10 (c-Jun N-terminal kinase) [EC:2.7.11.24]
Organism
sgh  Sinocyclocheilus grahami
Pathway
sgh04010  MAPK signaling pathway
sgh04012  ErbB signaling pathway
sgh04068  FoxO signaling pathway
sgh04137  Mitophagy - animal
sgh04140  Autophagy - animal
sgh04141  Protein processing in endoplasmic reticulum
sgh04210  Apoptosis
sgh04217  Necroptosis
sgh04310  Wnt signaling pathway
sgh04510  Focal adhesion
sgh04530  Tight junction
sgh04620  Toll-like receptor signaling pathway
sgh04621  NOD-like receptor signaling pathway
sgh04622  RIG-I-like receptor signaling pathway
sgh04625  C-type lectin receptor signaling pathway
sgh04910  Insulin signaling pathway
sgh04912  GnRH signaling pathway
sgh04914  Progesterone-mediated oocyte maturation
sgh04920  Adipocytokine signaling pathway
sgh05132  Salmonella infection
Brite
KEGG Orthology (KO) [BR:sgh00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    107548633
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    107548633
   04012 ErbB signaling pathway
    107548633
   04310 Wnt signaling pathway
    107548633
   04068 FoxO signaling pathway
    107548633
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    107548633
   04137 Mitophagy - animal
    107548633
  09143 Cell growth and death
   04210 Apoptosis
    107548633
   04217 Necroptosis
    107548633
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    107548633
   04530 Tight junction
    107548633
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    107548633
   04621 NOD-like receptor signaling pathway
    107548633
   04622 RIG-I-like receptor signaling pathway
    107548633
   04625 C-type lectin receptor signaling pathway
    107548633
  09152 Endocrine system
   04910 Insulin signaling pathway
    107548633
   04920 Adipocytokine signaling pathway
    107548633
   04912 GnRH signaling pathway
    107548633
   04914 Progesterone-mediated oocyte maturation
    107548633
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    107548633
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:sgh01001]
    107548633
Enzymes [BR:sgh01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     107548633
Protein kinases [BR:sgh01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   107548633
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Kdo RIO1 APH Kinase-like FTA2
Other DBs
NCBI-GeneID: 107548633
NCBI-ProteinID: XP_016084885
UniProt: A0A672RLM7
LinkDB
Position
Unknown
AA seq 427 aa
MNKNKQEKEFYSVDVGDSTFTVLKRYQNLRPIGSGAQGIVCSAYDHNLERNVAIKKLSRP
FQNQTHAKRAYRELVLMKCVNHKNIICLLNVFTSQKSLDEFQDVYLVMELMDANLCQVIQ
MELDHERLSYLLYQMLCGIKHLHSAGIIHRDLKPSNIVVKSDCTLKILDFGLARTAATGL
LMTPYVVTRYYRAPEVILGMGYQANVDVWSVGCIMAEMVRGSVLFPGSDHIDQWNKVIEQ
LGTPSQEFMTKLNQSVRTYVENRPRYTGYSFEKLFPDVLFPADSEHNKLKASQARDLLSK
MLVIDASKRISVEEALQHPYINVWYDPAEVEAPPPLITDKQLDERDHTVEEWKELIYKEV
LDLEEWMKNGVIRGQPSPLGAAVINGSPQPSSSSSINDVSSMSTEPTVASDTDSSLEASA
GPLSCCR
NT seq 1284 nt   +upstreamnt  +downstreamnt
atgaacaaaaataagcaagaaaaagaattctacagcgtagatgtgggtgattcaacattc
acagtgttgaagcggtatcagaatctaagacccattggctcgggtgctcagggaatagtc
tgctcagcgtatgaccacaaccttgagcgaaatgtggctataaagaaactcagccggcct
tttcagaatcagactcatgccaaacgcgcatacagagagctggtgctcatgaagtgtgtc
aaccataaaaacataatatgtctgttaaatgtttttacatcacaaaaatcattagacgaa
ttccaagatgtttacctagtaatggagctgatggatgccaacctctgccaagtcattcag
atggagctggaccacgagcggctgtcctatttgctgtaccagatgctgtgcggaataaaa
cacctccactcggcggggatcatccacagggatctaaaacccagtaacattgtggtaaag
tcagactgtaccctgaagatcctggatttcggtctggccaggacagcagctacaggtctg
ctgatgacaccatatgtggtgacacgttactacagggcccctgaagtcatcctgggaatg
ggatatcaagccaatgtggatgtatggtctgttggctgtatcatggctgaaatggtcaga
ggtagtgtgttgtttccgggttcagatcatattgatcagtggaacaaagtcatagagcag
ctgggaacaccatctcaggagttcatgacgaaactcaaccagtctgtgcggacctatgtg
gagaacaggccgcggtacactggatacagctttgagaagctctttcccgatgtcctgttc
cctgctgattcagaacacaacaaactgaaagcaagccaggcgcgggacctgctgtctaaa
atgctggtgatagatgcatccaagcgaatctctgtagaggaagctctgcagcacccctac
attaacgtgtggtacgacccagctgaagtggaagcgccacctcctctaatcacagacaaa
cagctcgatgagagggatcacacagtggaggagtggaaagagctgatctataaagaagtc
ctggatttggaagaatggatgaaaaacggtgttattcgaggtcagccttcccctctaggt
gcagcagtgatcaacggctcaccccagccctcctcctcttcctccatcaatgatgtctcc
tccatgtccacagagcccaccgtggcctctgacacagacagcagccttgaggcctccgca
ggacccctgagctgctgcagatga

KEGG   Sinocyclocheilus grahami: 107565387
Entry
107565387         CDS       T04918                                 

Gene name
mapk10
Definition
(RefSeq) mitogen-activated protein kinase 10 isoform X1
  KO
K04440  mitogen-activated protein kinase 8/9/10 (c-Jun N-terminal kinase) [EC:2.7.11.24]
Organism
sgh  Sinocyclocheilus grahami
Pathway
sgh04010  MAPK signaling pathway
sgh04012  ErbB signaling pathway
sgh04068  FoxO signaling pathway
sgh04137  Mitophagy - animal
sgh04140  Autophagy - animal
sgh04141  Protein processing in endoplasmic reticulum
sgh04210  Apoptosis
sgh04217  Necroptosis
sgh04310  Wnt signaling pathway
sgh04510  Focal adhesion
sgh04530  Tight junction
sgh04620  Toll-like receptor signaling pathway
sgh04621  NOD-like receptor signaling pathway
sgh04622  RIG-I-like receptor signaling pathway
sgh04625  C-type lectin receptor signaling pathway
sgh04910  Insulin signaling pathway
sgh04912  GnRH signaling pathway
sgh04914  Progesterone-mediated oocyte maturation
sgh04920  Adipocytokine signaling pathway
sgh05132  Salmonella infection
Brite
KEGG Orthology (KO) [BR:sgh00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    107565387 (mapk10)
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    107565387 (mapk10)
   04012 ErbB signaling pathway
    107565387 (mapk10)
   04310 Wnt signaling pathway
    107565387 (mapk10)
   04068 FoxO signaling pathway
    107565387 (mapk10)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    107565387 (mapk10)
   04137 Mitophagy - animal
    107565387 (mapk10)
  09143 Cell growth and death
   04210 Apoptosis
    107565387 (mapk10)
   04217 Necroptosis
    107565387 (mapk10)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    107565387 (mapk10)
   04530 Tight junction
    107565387 (mapk10)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    107565387 (mapk10)
   04621 NOD-like receptor signaling pathway
    107565387 (mapk10)
   04622 RIG-I-like receptor signaling pathway
    107565387 (mapk10)
   04625 C-type lectin receptor signaling pathway
    107565387 (mapk10)
  09152 Endocrine system
   04910 Insulin signaling pathway
    107565387 (mapk10)
   04920 Adipocytokine signaling pathway
    107565387 (mapk10)
   04912 GnRH signaling pathway
    107565387 (mapk10)
   04914 Progesterone-mediated oocyte maturation
    107565387 (mapk10)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    107565387 (mapk10)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:sgh01001]
    107565387 (mapk10)
Enzymes [BR:sgh01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     107565387 (mapk10)
Protein kinases [BR:sgh01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   107565387 (mapk10)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Kdo Kinase-like RIO1 APH FTA2
Other DBs
NCBI-GeneID: 107565387
NCBI-ProteinID: XP_016106090
UniProt: A0A672Q1C4
LinkDB
Position
Unknown
AA seq 472 aa
MNRRFLYNCSAPVLDVKIAFCQGFGKQVDVSYIAQHYNMSKSKVDNQFYSVEVGDSTFTV
LKRYQNLKPIGSGAQGIVCAGYDAVLDRNVAIKKLSRPFQNQTHAKRAYRELVLMKCVNH
KNIISLLNVFTPQKSLEDFQDVYLVMELMDANLCQVIQMELDHERMSYLLYQMLCGIKHL
HSAGIIHRDLKPSNIVVKSDCTLKILDFGLARTAGTSFMMTPYVVTRYYRAPEVILGMGY
KENVDIWSVGCIMGEMVRHKILFPGRDYIDQWNKVIEQLGTPSPEFMKKLQPTVRNYVEN
RPKYAGLTFPKLFPDCLFPADSEHNKLKASQARDLLSKMLIIDPAKRISVDEALQHPYIN
VWYDPAEVEAARNQQISMPPPQIYDKQLDEREHSIDEWKELIYKEVMNFEERTKNGVVKG
QPSPSGAAMNSSESLPPSSSVNDISSMSTDQTLASDTDSSLETSTGPLGCCR
NT seq 1419 nt   +upstreamnt  +downstreamnt
atgaacagacgtttcttatataactgcagtgctccagtcctggatgtgaagattgccttt
tgtcaggggtttggcaaacaagttgatgtttcttacattgcccagcattacaacatgagt
aaaagcaaagtggacaaccagttctacagtgtggaagtaggagattccaccttcacggtt
ctcaaacggtaccaaaatctaaagcccatcggttctggggctcagggaatagtgtgtgct
ggatatgatgccgtcctggacagaaatgtggccattaagaaactcagcagaccttttcag
aaccagactcacgccaagagagcatacagggagctggtgcttatgaaatgtgtcaatcac
aaaaacatcatcagcttattaaatgtcttcacaccacagaagtctttagaggattttcaa
gatgtttacctggtcatggagctgatggatgcaaacctttgccaggtgattcagatggaa
ctggaccacgagaggatgtcctacctgctgtaccagatgttatgtggaatcaaacacctg
cactcagccggcatcatccacagggatctgaaacctagcaatattgtggtgaaatccgac
tgtaccctgaagatcttggactttggcttggcgagaaccgctggcactagctttatgatg
acgccctacgtggtgacgcggtactacagggccccggaggtcatcctgggcatgggctac
aaggagaacgtggatatttggtcagttggttgcatcatgggagaaatggtgcgccacaaa
atcctattccccggcagggattacatcgaccaatggaataaggttatagagcagctcggc
acgccctctcctgagttcatgaagaaactgcagccgacggtgcgtaactatgtggagaac
aggccaaaatacgccggcctgaccttccccaaactcttccctgattgcctcttccctgca
gactcggagcacaacaagctcaaagctagtcaggccagagacctgctgtctaagatgctg
atcattgatcccgctaagcggatctcagtggacgaggccctgcagcacccctacatcaac
gtgtggtacgacccggccgaggtggaggcagccaggaatcagcagatatctatgcctcct
ccacagatctatgataaacagctagatgagagggaacactcgattgatgaatggaaagag
ctcatctataaagaggtgatgaacttcgaggagagaacaaagaatggtgttgtgaaggga
cagccctctccctcaggtgcagccatgaacagcagcgagagcctccccccttcctcctcc
gtcaacgacatctcctccatgtccaccgaccagaccctggcctccgataccgacagcagc
ttggagacctccaccggaccgctggggtgctgcaggtga

KEGG   Sinocyclocheilus grahami: 107566214
Entry
107566214         CDS       T04918                                 

Definition
(RefSeq) mitogen-activated protein kinase 9-like isoform X1
  KO
K04440  mitogen-activated protein kinase 8/9/10 (c-Jun N-terminal kinase) [EC:2.7.11.24]
Organism
sgh  Sinocyclocheilus grahami
Pathway
sgh04010  MAPK signaling pathway
sgh04012  ErbB signaling pathway
sgh04068  FoxO signaling pathway
sgh04137  Mitophagy - animal
sgh04140  Autophagy - animal
sgh04141  Protein processing in endoplasmic reticulum
sgh04210  Apoptosis
sgh04217  Necroptosis
sgh04310  Wnt signaling pathway
sgh04510  Focal adhesion
sgh04530  Tight junction
sgh04620  Toll-like receptor signaling pathway
sgh04621  NOD-like receptor signaling pathway
sgh04622  RIG-I-like receptor signaling pathway
sgh04625  C-type lectin receptor signaling pathway
sgh04910  Insulin signaling pathway
sgh04912  GnRH signaling pathway
sgh04914  Progesterone-mediated oocyte maturation
sgh04920  Adipocytokine signaling pathway
sgh05132  Salmonella infection
Brite
KEGG Orthology (KO) [BR:sgh00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    107566214
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    107566214
   04012 ErbB signaling pathway
    107566214
   04310 Wnt signaling pathway
    107566214
   04068 FoxO signaling pathway
    107566214
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    107566214
   04137 Mitophagy - animal
    107566214
  09143 Cell growth and death
   04210 Apoptosis
    107566214
   04217 Necroptosis
    107566214
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    107566214
   04530 Tight junction
    107566214
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    107566214
   04621 NOD-like receptor signaling pathway
    107566214
   04622 RIG-I-like receptor signaling pathway
    107566214
   04625 C-type lectin receptor signaling pathway
    107566214
  09152 Endocrine system
   04910 Insulin signaling pathway
    107566214
   04920 Adipocytokine signaling pathway
    107566214
   04912 GnRH signaling pathway
    107566214
   04914 Progesterone-mediated oocyte maturation
    107566214
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    107566214
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:sgh01001]
    107566214
Enzymes [BR:sgh01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     107566214
Protein kinases [BR:sgh01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   107566214
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Kdo APH RIO1 Kinase-like
Other DBs
NCBI-GeneID: 107566214
NCBI-ProteinID: XP_016107072
UniProt: A0A672L9K4
LinkDB
Position
Unknown
AA seq 422 aa
MTEGEGQFYSVQVGDSTFTVLRRYQQLRAIGSGAQGIVCSALDTVLGIPVAVKKLSRPFQ
NQTHAKRAYRELVLLKCVNHKNIIHLLNVFTPQKSLEEFQDLYLVMELMDASLCQVIHMD
LDHERMSYLLYQILCGIRHLHSAGIIHRDLKPSNIVVKSDCTLKILDFGLARTACTNFMM
TPYVVTRYYRAPEVILGMKYKENVDIWSVGCIMGEMVKGSVIFQGTDHIDQWNKVIEILG
TPSLEFMNRLMETVRNYVMNKPQFPGVSFNELFPDWAFPSETEHDQIKTSQARDLLSKML
VIDPESRISVQEALSHPYIHVWYDPAEADTPPPQISDKQLEEREHSIEQWKELIYKEVMD
WEERNKNGVLKEECLVDGMVNSSTTASQSSSINDISSMSTEQTLASDTDSSCIDTLTGPL
EE
NT seq 1269 nt   +upstreamnt  +downstreamnt
atgaccgagggggaggggcagttctacagcgtgcaggtgggtgactccacctttacagtg
ctcagaaggtaccagcagctccgcgccatcggatccggtgcccagggtatcgtctgctcc
gctctggacactgtacttggcatcccagtcgctgtgaagaaactgagccgaccctttcag
aaccagacccatgcaaagagggcttacagagagctggttctgctcaagtgtgttaatcac
aagaatatcatccatttgcttaatgtcttcacaccccagaagtcattggaagagtttcag
gatttgtacttggtaatggaactgatggacgctagcctttgtcaggtgatccatatggac
ctggaccatgagaggatgtcttacctgctctaccagatcctgtgtggcatcagacatcta
cactcagctggcatcattcacagggatctgaagcccagtaacatcgtagtgaagtctgac
tgcaccttaaagatcctagacttcgggctggccagaaccgcctgcactaacttcatgatg
acgccctacgtagtaaccagatactacagagcaccagaggtcatcttgggcatgaaatat
aaggagaatgttgatatctggtcggtgggttgcatcatgggtgagatggtcaaaggaagt
gtcatattccagggcactgatcatattgaccagtggaataaagtgattgagattctggga
accccctctctggagtttatgaatcgtttaatggagactgtaaggaactatgtgatgaac
aaaccccagtttcctggagtcagttttaacgagctttttcccgattgggccttcccttca
gagactgagcatgaccagatcaaaactagtcaagcacgagacctgctgtccaagatgctg
gtaatcgacccagaaagccgcatctctgtgcaggaggccctcagtcacccttacatccat
gtgtggtacgacccagccgaggccgatacgcctccaccgcagatatcagacaagcagttg
gaggagcgggaacacagcattgagcagtggaaagagttgatttataaagaagtaatggac
tgggaggagaggaacaagaacggagtgctgaaagaggagtgtttagtagacggtatggtg
aacagcagcaccactgcctcccagtcatcctctattaacgacatctcgtccatgtcgacg
gagcagacattggcctcagacaccgacagctcctgcatcgacaccctcacaggaccgtta
gaggagtga

KEGG   Sinocyclocheilus grahami: 107571265
Entry
107571265         CDS       T04918                                 

Definition
(RefSeq) mitogen-activated protein kinase 8 isoform X1
  KO
K04440  mitogen-activated protein kinase 8/9/10 (c-Jun N-terminal kinase) [EC:2.7.11.24]
Organism
sgh  Sinocyclocheilus grahami
Pathway
sgh04010  MAPK signaling pathway
sgh04012  ErbB signaling pathway
sgh04068  FoxO signaling pathway
sgh04137  Mitophagy - animal
sgh04140  Autophagy - animal
sgh04141  Protein processing in endoplasmic reticulum
sgh04210  Apoptosis
sgh04217  Necroptosis
sgh04310  Wnt signaling pathway
sgh04510  Focal adhesion
sgh04530  Tight junction
sgh04620  Toll-like receptor signaling pathway
sgh04621  NOD-like receptor signaling pathway
sgh04622  RIG-I-like receptor signaling pathway
sgh04625  C-type lectin receptor signaling pathway
sgh04910  Insulin signaling pathway
sgh04912  GnRH signaling pathway
sgh04914  Progesterone-mediated oocyte maturation
sgh04920  Adipocytokine signaling pathway
sgh05132  Salmonella infection
Brite
KEGG Orthology (KO) [BR:sgh00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    107571265
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    107571265
   04012 ErbB signaling pathway
    107571265
   04310 Wnt signaling pathway
    107571265
   04068 FoxO signaling pathway
    107571265
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    107571265
   04137 Mitophagy - animal
    107571265
  09143 Cell growth and death
   04210 Apoptosis
    107571265
   04217 Necroptosis
    107571265
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    107571265
   04530 Tight junction
    107571265
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    107571265
   04621 NOD-like receptor signaling pathway
    107571265
   04622 RIG-I-like receptor signaling pathway
    107571265
   04625 C-type lectin receptor signaling pathway
    107571265
  09152 Endocrine system
   04910 Insulin signaling pathway
    107571265
   04920 Adipocytokine signaling pathway
    107571265
   04912 GnRH signaling pathway
    107571265
   04914 Progesterone-mediated oocyte maturation
    107571265
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    107571265
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:sgh01001]
    107571265
Enzymes [BR:sgh01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     107571265
Protein kinases [BR:sgh01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   107571265
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Kdo APH RIO1 Kinase-like
Other DBs
NCBI-GeneID: 107571265
NCBI-ProteinID: XP_016113065
LinkDB
Position
Unknown
AA seq 422 aa
MNRNKREKEYYSIDVGDSTFTVLKRYQNLRPIGSGAQGIVCSAYDHVLERNVAIKKLSRP
FQNQTHAKRAYRELVLMKCVNHKNIIGLLHVFTPQKTLEEFQDVYLVMELMDANLCQVIQ
MELDHERLSYLLYQMLCGIKHLHAAGIIHRDLKPSNIVVKSDCTLKILDFGLARTAATGL
LMTPYVVTRYYRAPEVILGMGYQANVDVWSVGCIMAEMVRGSVLFPGTDHIDQWNKVIEQ
LGTPSQEFMLKLNQSVRTYVENRPRYAGYSFEKLFPDVLFPADSDHNKLKASQARDLLSK
MLVIDTSKRISVDEALQHPYINVWFDPSEVEAPPPAITDKQLDEREHTVEEWKELIYKEV
LDWEERTKNGVIRGQPASLGAAVSNDSHEPSTSSSSTNDVSSMSTDTDSSQEASAGPLGC
CR
NT seq 1269 nt   +upstreamnt  +downstreamnt
atgaacaggaataagcgcgagaaggaatattacagcatagatgtaggagattcaacgttt
accgttttgaagcgatatcagaatttaagaccaatcggatctggggcacaaggcatcgtc
tgctcagcgtatgatcatgtcctcgaacgaaatgttgcaattaagaaacttagccgaccc
tttcagaaccaaacccacgccaaacgggcctacagagaactggtgctgatgaaatgtgtc
aaccacaaaaatataataggcttactacacgtgttcacgccacagaagacacttgaagaa
ttccaggatgtgtatctggtgatggagctgatggatgctaacctgtgccaggtcattcag
atggagctggaccacgagagactctcatacctgctttatcagatgctctgcggcatcaaa
cacctacacgctgctggcatcatacacagggatctgaagcccagtaacatagtagtgaaa
tccgactgtacgctgaagatcctggacttcggtctggcccggacagccgccaccggcctc
ctcatgactccttacgtggtgacgcgctactaccgggcccctgaggtcattctgggcatg
ggttaccaagccaatgttgatgtctggtctgttggctgcatcatggctgaaatggtcaga
ggtagtgtgttgtttcccggcacagaccacattgaccagtggaacaaggtgatcgagcag
ctgggcacaccgtctcaggagttcatgctgaagctcaaccagtctgtgaggacttacgtg
gagaaccggccccgctatgctggatacagctttgagaagctcttcccagacgttctgttc
cctgcagactccgaccacaacaaactgaaggcgagccaggcgcgagacttgttatccaaa
atgctggtaatagatacgtccaaacgcatctcggtggacgaggccctccagcacccctac
atcaacgtgtggttcgacccgtcagaagtggaagcgccgccgccggcgatcaccgataaa
cagctggatgagagagaacacacggtggaggagtggaaagagctgatatataaggaagtg
ctggattgggaggaacgaacgaaaaacggggtgatccgaggacagccggcctcactaggt
gcagcagtgagcaatgactcccacgagccctcgacgtcctcgtcctccacaaacgacgtc
tcgtccatgtccaccgacacggacagcagtcaggaggcgagcgcaggaccgctgggctgc
tgcagatga

KEGG   Sinocyclocheilus grahami: 107584639
Entry
107584639         CDS       T04918                                 

Definition
(RefSeq) mitogen-activated protein kinase 10-like
  KO
K04440  mitogen-activated protein kinase 8/9/10 (c-Jun N-terminal kinase) [EC:2.7.11.24]
Organism
sgh  Sinocyclocheilus grahami
Pathway
sgh04010  MAPK signaling pathway
sgh04012  ErbB signaling pathway
sgh04068  FoxO signaling pathway
sgh04137  Mitophagy - animal
sgh04140  Autophagy - animal
sgh04141  Protein processing in endoplasmic reticulum
sgh04210  Apoptosis
sgh04217  Necroptosis
sgh04310  Wnt signaling pathway
sgh04510  Focal adhesion
sgh04530  Tight junction
sgh04620  Toll-like receptor signaling pathway
sgh04621  NOD-like receptor signaling pathway
sgh04622  RIG-I-like receptor signaling pathway
sgh04625  C-type lectin receptor signaling pathway
sgh04910  Insulin signaling pathway
sgh04912  GnRH signaling pathway
sgh04914  Progesterone-mediated oocyte maturation
sgh04920  Adipocytokine signaling pathway
sgh05132  Salmonella infection
Brite
KEGG Orthology (KO) [BR:sgh00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    107584639
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    107584639
   04012 ErbB signaling pathway
    107584639
   04310 Wnt signaling pathway
    107584639
   04068 FoxO signaling pathway
    107584639
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    107584639
   04137 Mitophagy - animal
    107584639
  09143 Cell growth and death
   04210 Apoptosis
    107584639
   04217 Necroptosis
    107584639
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    107584639
   04530 Tight junction
    107584639
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    107584639
   04621 NOD-like receptor signaling pathway
    107584639
   04622 RIG-I-like receptor signaling pathway
    107584639
   04625 C-type lectin receptor signaling pathway
    107584639
  09152 Endocrine system
   04910 Insulin signaling pathway
    107584639
   04920 Adipocytokine signaling pathway
    107584639
   04912 GnRH signaling pathway
    107584639
   04914 Progesterone-mediated oocyte maturation
    107584639
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    107584639
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:sgh01001]
    107584639
Enzymes [BR:sgh01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     107584639
Protein kinases [BR:sgh01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   107584639
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Kdo Kinase-like RIO1 APH FTA2
Other DBs
NCBI-GeneID: 107584639
NCBI-ProteinID: XP_016126835
LinkDB
Position
Unknown
AA seq 490 aa
MVFMNRRFLYNCSAPVLDVKIAFCQGFGKQVDVSYIAQHYNMSKSKVDNQFYSVEVGDST
FTVLKRYQNLKPIGSGAQGIVCFSGSGTVVWSRQGGSTGLLMALLMCSGWFAGCAIGYLF
SDAKRAYRELVLMKCVNHKNIISLLNVFTPQKSLEEFQDVYLVMELMDANLCQVIQMELD
HERMSYLLYQMLCGIKHLHSAGIIHRDLKPSNIVVKSDCTLKILDFGLARTAGTSFMMTP
YVVTRYYRAPEVILGMGYKENVDIWSVGCIMGEMVRHKILFPGRDYIDQWNKVIEQLGTP
SPEFMKKLQPTVRNYVENRPKYAGLTFPKLFPDCLFPADSEHNKLKASQARDLLSKMLII
DPAKRISVDEALQHPYINVWYDPTEVEAARNQQISMPPPQIYDKQLDEREHSIDEWKELI
YKEVMNFEERTKNGVVKGQPSPSGAAVNSSDSLPPSSSVNDISSMSTDQTLASDTDSSLE
TSAGPLGCCR
NT seq 1473 nt   +upstreamnt  +downstreamnt
atggtatttatgaacagacgtttcttatataactgcagtgctccagtcctggatgtgaag
attgccttttgtcaggggtttggtaaacaagttgatgtttcttacattgcccagcattac
aacatgagcaaaagcaaagtggacaaccagttctacagtgtggaagtaggagattccacc
ttcacggttctcaaacggtaccaaaatctaaagcccatcggttctggggctcagggaata
gtgtgtttcagtggcagcggtacggttgtgtggagcaggcagggaggcagcactggactg
ttaatggctttgttgatgtgttctggctggtttgctggctgcgccattggctacttgttt
tctgatgccaagagagcatacagggagctggtgcttatgaaatgtgtcaatcacaaaaac
atcatcagcttattaaatgtcttcacaccacagaagtctttagaggaattccaagatgtt
tacctggtcatggagctgatggacgcaaacctttgccaggtgattcagatggagctggac
cacgagaggatgtcctacctgctgtaccagatgttgtgtggaatcaaacacctgcactca
gccggcatcatccacagggatctgaaacctagcaatattgtggtgaaatccgactgtacg
ctgaagatcttggactttgggttggcgagaactgctggcactagctttatgatgacgccc
tacgtggtgacgcggtactacagggccccggaggtcatcctgggcatgggatacaaggag
aacgtggatatttggtcagttggttgcatcatgggagaaatggtgcgccacaaaatccta
ttccctggcagggattacattgaccaatggaataaggttatagagcagctcggcacgccc
tctcctgagttcatgaagaaactgcagccgacggtgcgtaactacgtggagaacaggcca
aaatatgccggcctgaccttccccaaactcttccctgattgcctcttccctgcagactca
gagcacaacaaactcaaagctagtcaggccagagacctgctgtctaagatgttgatcatt
gatcccgctaagcggatctcagtggacgaggccctgcagcacccctacatcaacgtgtgg
tacgacccgaccgaggtggaggcagccaggaatcagcagatatctatgcctcctccacag
atctatgataaacagctagatgagagggaacactcgattgatgaatggaaagagctcatc
tataaagaggtgatgaacttcgaggagagaacaaagaatggtgtggtgaagggacagccc
tctccctcaggtgcagccgtgaacagcagcgacagcctccccccctcctcctctgtcaac
gacatctcctccatgtccaccgaccagaccttggcctctgataccgacagcagcctggag
acctccgccggaccactggggtgctgcaggtga

KEGG   Sinocyclocheilus grahami: 107588610
Entry
107588610         CDS       T04918                                 

Definition
(RefSeq) mitogen-activated protein kinase 8B isoform X1
  KO
K04440  mitogen-activated protein kinase 8/9/10 (c-Jun N-terminal kinase) [EC:2.7.11.24]
Organism
sgh  Sinocyclocheilus grahami
Pathway
sgh04010  MAPK signaling pathway
sgh04012  ErbB signaling pathway
sgh04068  FoxO signaling pathway
sgh04137  Mitophagy - animal
sgh04140  Autophagy - animal
sgh04141  Protein processing in endoplasmic reticulum
sgh04210  Apoptosis
sgh04217  Necroptosis
sgh04310  Wnt signaling pathway
sgh04510  Focal adhesion
sgh04530  Tight junction
sgh04620  Toll-like receptor signaling pathway
sgh04621  NOD-like receptor signaling pathway
sgh04622  RIG-I-like receptor signaling pathway
sgh04625  C-type lectin receptor signaling pathway
sgh04910  Insulin signaling pathway
sgh04912  GnRH signaling pathway
sgh04914  Progesterone-mediated oocyte maturation
sgh04920  Adipocytokine signaling pathway
sgh05132  Salmonella infection
Brite
KEGG Orthology (KO) [BR:sgh00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    107588610
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    107588610
   04012 ErbB signaling pathway
    107588610
   04310 Wnt signaling pathway
    107588610
   04068 FoxO signaling pathway
    107588610
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    107588610
   04137 Mitophagy - animal
    107588610
  09143 Cell growth and death
   04210 Apoptosis
    107588610
   04217 Necroptosis
    107588610
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    107588610
   04530 Tight junction
    107588610
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    107588610
   04621 NOD-like receptor signaling pathway
    107588610
   04622 RIG-I-like receptor signaling pathway
    107588610
   04625 C-type lectin receptor signaling pathway
    107588610
  09152 Endocrine system
   04910 Insulin signaling pathway
    107588610
   04920 Adipocytokine signaling pathway
    107588610
   04912 GnRH signaling pathway
    107588610
   04914 Progesterone-mediated oocyte maturation
    107588610
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    107588610
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:sgh01001]
    107588610
Enzymes [BR:sgh01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     107588610
Protein kinases [BR:sgh01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   107588610
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Kdo APH RIO1 Kinase-like
Other DBs
NCBI-GeneID: 107588610
NCBI-ProteinID: XP_016132249
LinkDB
Position
Unknown
AA seq 426 aa
MNKNKREKEFYSVDVGDSTFTVLKRYQNLRPIGSGAQGIVCSAYDHNLERNVAIKKLSRP
FQNQTHAKRAFRELVLMKCVNHKNIIGLLNVFTPQKTLEEFQDVYLVMELMDANLCQVIQ
MELDHERLSYLLYQTLCGIKHLHSAGIIHRDLKPSNIVVKSDCTLKILDFGLARTAATGL
LMTPYVVTRYYRAPEVILGMGYQANVDVWSVGCIMAEIVRGSVLFPGSDHIDQWNKVIEQ
LGTPSQEFMMKLNQSVRTYVENRPRYTGYSFEKLFPDVLFPADSEHNKLKASQARDLLSR
MLVIDASKRISVDEALQHPYINVWYDPAEVEAPPPLITDKQLNEREHTVEEWKELIYKEV
LDWEERIKNVIRGQPSPIGAAVINGSPQPSSSSSINDVSSMSTEPTVASDTDSSLEASAG
PLSCCR
NT seq 1281 nt   +upstreamnt  +downstreamnt
atgaacaaaaataagcgagagaaagaattctacagcgtagatgtgggagattcaacattc
acagtgttgaagcggtatcagaatctaagacccattggctcgggtgctcagggaatagtc
tgctcagcgtatgaccacaaccttgagcgaaatgtggctataaagaaactcagccggcct
tttcagaatcagactcatgccaaacgcgcattcagagagctggtgctcatgaagtgtgtc
aaccataaaaatataataggcctcttaaatgtttttacaccacaaaaaacattagaagaa
ttccaagatgtttacctagtaatggagctgatggacgccaacctctgccaagtcattcag
atggagctggaccacgagcggctgtcctatctgctgtaccagacgctgtgcggaataaaa
cacctccactcggcgggaatcatccacagggatctgaaacccagcaacatcgtggtaaag
tcagactgtaccctgaagatcctggatttcggactggctaggacagcagctacgggtctg
ctgatgacaccatatgtcgtgacacgttactacagagcccctgaagtcatcctgggaatg
ggatatcaagccaatgtggatgtatggtctgttggctgtatcatggctgaaatagtcaga
ggtagtgtgttgtttccaggttcagatcatattgatcagtggaacaaagtcatagagcag
ctgggaacaccatcccaggagtttatgatgaaactcaaccagtctgtgcggacctacgtg
gagaacaggccccggtacactggatacagctttgagaagctctttcccgacgtcctgttc
cctgctgattcagaacacaacaaactgaaagcgagccaggcgcgggacctgctgtctaga
atgctggtgatagatgcatccaaacgaatatctgtggatgaagctctgcagcacccctac
attaacgtgtggtacgacccagctgaagtggaagcgccacctcctctaatcacagacaaa
cagctcaatgagagggaacacacagtggaggaatggaaagagctgatctataaagaagtc
ctggattgggaagaacggataaaaaatgtaattcgaggtcagccttcccctataggtgca
gcagtgatcaacggctcaccccagccctcctcctcttcctccatcaatgacgtctcgtcc
atgtccacagagcccaccgtggcctcagacacagacagcagcctggaggcctctgcggga
cccctgagctgctgcagatga

KEGG   Sinocyclocheilus grahami: 107590058
Entry
107590058         CDS       T04918                                 

Definition
(RefSeq) mitogen-activated protein kinase 9-like
  KO
K04440  mitogen-activated protein kinase 8/9/10 (c-Jun N-terminal kinase) [EC:2.7.11.24]
Organism
sgh  Sinocyclocheilus grahami
Pathway
sgh04010  MAPK signaling pathway
sgh04012  ErbB signaling pathway
sgh04068  FoxO signaling pathway
sgh04137  Mitophagy - animal
sgh04140  Autophagy - animal
sgh04141  Protein processing in endoplasmic reticulum
sgh04210  Apoptosis
sgh04217  Necroptosis
sgh04310  Wnt signaling pathway
sgh04510  Focal adhesion
sgh04530  Tight junction
sgh04620  Toll-like receptor signaling pathway
sgh04621  NOD-like receptor signaling pathway
sgh04622  RIG-I-like receptor signaling pathway
sgh04625  C-type lectin receptor signaling pathway
sgh04910  Insulin signaling pathway
sgh04912  GnRH signaling pathway
sgh04914  Progesterone-mediated oocyte maturation
sgh04920  Adipocytokine signaling pathway
sgh05132  Salmonella infection
Brite
KEGG Orthology (KO) [BR:sgh00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    107590058
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    107590058
   04012 ErbB signaling pathway
    107590058
   04310 Wnt signaling pathway
    107590058
   04068 FoxO signaling pathway
    107590058
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    107590058
   04137 Mitophagy - animal
    107590058
  09143 Cell growth and death
   04210 Apoptosis
    107590058
   04217 Necroptosis
    107590058
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    107590058
   04530 Tight junction
    107590058
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    107590058
   04621 NOD-like receptor signaling pathway
    107590058
   04622 RIG-I-like receptor signaling pathway
    107590058
   04625 C-type lectin receptor signaling pathway
    107590058
  09152 Endocrine system
   04910 Insulin signaling pathway
    107590058
   04920 Adipocytokine signaling pathway
    107590058
   04912 GnRH signaling pathway
    107590058
   04914 Progesterone-mediated oocyte maturation
    107590058
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    107590058
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:sgh01001]
    107590058
Enzymes [BR:sgh01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     107590058
Protein kinases [BR:sgh01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   107590058
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Kdo APH RIO1 Kinase-like DDE_Tnp_1_7
Other DBs
NCBI-GeneID: 107590058
NCBI-ProteinID: XP_016134158
UniProt: A0A672LM87
LinkDB
Position
Unknown
AA seq 421 aa
MTEGEGQFYSVQVGDSTFTVLRRFQQLRAIGSGAQGIVCSALDTVLGIPVAVKKLSRPFQ
NQTHAKRAYRELVLLKCVDHKNIIRLLNVFTPQKSLEEFQDLYLVMELMDASLCQVIHMD
LDHERMSYLLYQILCGIRHLHSVGIIHRDLKPSNIVVKSDCTLKILDFGLARTACTNFMM
TPYVVTRYYRAPEVILGMKYKENVDIWSVGCIMGEMVKGSVIFQGTDHIDQWNKVIEILG
TPSLEFMNRLMETVRNYVLNKPQFPGVSFNELFPDWAFPSETEHDKIKTSQARDLLSKML
VIDPESRISVQEALNHPYIRVWYDPAEADAPPPQISDKQLEEREHSIEQWKELIYKEVMD
WDERNKNGVLKEECLDGTLNSSTTASQSSSINDISSMSTEQTLASDTDSSCIDTLTGPLE
E
NT seq 1266 nt   +upstreamnt  +downstreamnt
atgaccgagggggaggggcagttctacagcgtgcaggtgggtgactccacctttacagtg
ctcagaaggttccagcagctccgcgccatcggatccggtgcccagggtatcgtctgctcc
gctctggacaccgttcttggcatcccagtcgctgtgaagaagctgagccggccctttcag
aaccagacccatgcgaagagggcttacagagagctggttctgctcaagtgtgttgatcac
aagaacatcatccgtttgcttaatgtcttcacaccccagaagtcattggaagagtttcag
gatttgtacttggtaatggaactgatggacgctagcctttgtcaagtgatccacatggac
ctagaccatgagaggatgtcttacctgctctaccagatcctgtgtggcatcagacatcta
cactcagttggcatcattcacagggatctgaagcctagtaacatcgtagtgaagtctgac
tgcacgctaaagatcttagactttgggctagccagaaccgcctgcactaacttcatgatg
acaccctacgtagtaaccagatactacagagcaccagaggtcatcttgggaatgaaatat
aaggagaatgtggatatctggtcggtgggctgcatcatgggtgagatggtcaaaggaagt
gtcatattccagggcactgatcatattgaccagtggaataaagtgattgagattctggga
accccctctctggagtttatgaaccgtttgatggagactgtaaggaattatgtgctgaac
aaaccccagtttcctggagtcagctttaatgagctttttcccgattgggccttcccttca
gagactgagcatgacaagatcaaaactagtcaagcacgagacctgctgtccaagatgctg
gtaatcgaccctgaaagccgcatctctgtgcaggaggccctcaatcacccttacattcgt
gtgtggtacgacccagccgaggctgatgcgcctcctccgcagatatcagacaagcagttg
gaggagcgggaacacagcattgagcagtggaaagagttgatttataaagaagtaatggac
tgggatgagaggaacaagaacggagtgctgaaagaggagtgtttagacggtacgctgaac
agcagcaccactgcctcacagtcatcctctattaacgacatctcgtccatgtcaacggag
cagacattggcctcagacaccgacagctcctgcatcgacaccctcacaggaccattagag
gagtga

DBGET integrated database retrieval system