KEGG   Sinocyclocheilus grahami: 107548717Help
Entry
107548717         CDS       T04918                                 

Definition
(RefSeq) caskin-2-like
  KO
K21952  CASK-interacting protein
Organism
sgh  Sinocyclocheilus grahami
Brite
KEGG Orthology (KO) [BR:sgh00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:sgh04131]
    107548717
Membrane trafficking [BR:sgh04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Kinases and associated proteins
    107548717
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ank_4 Ank_5 Ank_3 Ank_2 Ank
Motif
Other DBs
NCBI-GeneID: 107548717
NCBI-ProteinID: XP_016085003
LinkDB All DBs
Position
Unknown
AA seq 144 aa AA seqDB search
MVASLLEGDRKDGSDSNCNTPLHLAARNGHKDVIRLLLKAGIDINRTTKAGTALHEAALY
GKTEVVRQLLDNGIDVNIRNTYNQTALDIVNQFTACHASKDIKQLLREATGVLQVRALKD
FWNLHDPTALTIRAGDVITVRPLT
NT seq 435 nt NT seq  +upstreamnt  +downstreamnt
atggttgcgtctctgttagagggagatcggaaggacgggtcagactcaaactgtaacact
cctctgcacctcgccgctcgcaacggacacaaggacgtcattcggcttcttctaaaagca
ggtattgacatcaacagaaccactaaagctggcacagccctccatgaggccgctctctat
gggaagacagaggtagtgcggcaactcctggataatgggattgatgtcaatatccgtaac
acttacaatcaaacagccctagacattgtcaaccaattcaccgcatgtcacgccagcaaa
gacatcaagcagctcttacgagaagctacaggagttcttcaggtcagagctctgaaagac
ttctggaaccttcacgaccccacggccctcaccatacgcgccggtgatgtcatcacggta
cggccgcttacatga

DBGET integrated database retrieval system