KEGG   Sinocyclocheilus grahami: 107548920
Entry
107548920         CDS       T04918                                 

Definition
(RefSeq) nuclear factor of activated T-cells, cytoplasmic 3-like
  KO
K17333  nuclear factor of activated T-cells, cytoplasmic 3
Organism
sgh  Sinocyclocheilus grahami
Pathway
sgh04010  MAPK signaling pathway
sgh04218  Cellular senescence
sgh04310  Wnt signaling pathway
sgh04625  C-type lectin receptor signaling pathway
Brite
KEGG Orthology (KO) [BR:sgh00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    107548920
   04310 Wnt signaling pathway
    107548920
 09140 Cellular Processes
  09143 Cell growth and death
   04218 Cellular senescence
    107548920
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    107548920
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:sgh03000]
    107548920
Transcription factors [BR:sgh03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   RHR (Rel homology region) NF-AT
    107548920
SSDB
Motif
Pfam: RHD_dimer RHD_DNA_bind TIG DUF3304 DUF1977
Other DBs
NCBI-GeneID: 107548920
NCBI-ProteinID: XP_016085279
LinkDB
Position
Unknown
AA seq 820 aa
MTTANCPGNEELDFRLIFGEDGQQPPLGPADLETDENTSFYILNVGQPPLVVSQSHSLQR
HGGPPPAISPYLQAHHKTYEPIYELQDSKYTPTGVGGGGNGPPKTFECPSIQITSISPSC
QQEMETSENEMRAKGPDGDYHDRPLSRDHLYLPLDHSYRDSSLSPSPCSSLSSRSWFSDA
SSCESISHVYDDVDSELNEAAARFTLGSPLTSPGCSPQTGPHEEVWQQQQQQQHHHHMAF
THSLSHSHGHSLSPRQSPCHSPRTSVTDENWLSPRSPSRPSSRPTSPCGKRRHSSADICY
LGSLSPHHSPTATPGPSPRGSVTEDTWIGSPSMGVSSFQCCPSEADIPSKTRKTSQDCSG
AIQSGKGDLGMDDSGNVSPLLDSPAEEAMHGLKKDGSGEQFLSVPSHFTWNKPKPGHTPI
FRASSLPPLDWPLPNQYGQYELKIEVHPKAHHRAHYETEGSRGAVKATSGGHPVVKLVGY
NEKPVNLQMFIGTADDRYLRPHAFYQVHRITGKTVATASQEIIITSTKVLEIPLLPENNM
SASIDCAGILKLRNSDIELRKGETDIGRKNTRVRVVFRVHIPQPNGKVVSLQTVSIPVEC
SQRSAQELPQVEKASISSCPVSGGEEMVIIGSNFFPESKVIFLEKGPDGRPQWEVEAKII
REKSQGSSIMVEVPPYHSKTVTSAVQVQFYVCNGKRKRSQSQRFTYLPVRVKQEHRDDLD
SPAVPPMSMPLVHAASLVCTQPLSSPEHSHPPDGLLSSSPRGLAAGLHPLQAPCAPMGSP
TLPHLPHLQAQGLNAPPECQMPFHPGPAATARLSYPPSNV
NT seq 2463 nt   +upstreamnt  +downstreamnt
atgactactgcaaactgccccgggaatgaagagctggacttcagattgatcttcggggag
gacgggcagcagccgccgctaggccccgcagatctagaaacggatgaaaacacatcattt
tacatcctcaatgtggggcaacctcctttagtggtgagccaatcacacagtctccagcgg
catggaggccctcccccagccatctccccctacctgcaggcccaccacaagacctatgag
cccatctatgagctccaggactctaaatacacgcccacaggggtgggcggaggaggtaat
ggcccaccaaagacctttgaatgtcccagcatccagattacttccatctccccaagctgc
cagcaggagatggagaccagcgagaatgagatgagagcgaagggtccggatggagactac
cacgacagacctctgtctcgagaccacctgtacctgcctctagatcactcgtatcgagat
tcatccttgagcccgagcccatgtagcagcctttcctctcgtagctggttctctgacgca
tcgtcctgcgaatccatctcgcatgtatacgatgacgtggattcagagctaaatgaagca
gcggcccgtttcaccctgggctcgccactcacctcgcccggctgctctccacagactgga
ccacatgaggaagtgtggcaacagcagcagcagcagcagcatcatcatcacatggctttc
actcactctctttctcattcgcatggccattctctctcgccccgccagtcgccttgccac
tcaccccgtaccagcgtcacagatgagaactggcttagccctcgttcaccctcacggccc
tcttcacgtccaacatcgccctgcgggaagagacgccactccagcgctgatatatgctac
ctgggctctctatcaccccatcactccccgactgccacgcccggcccctcgcccaggggc
agcgtgaccgaagacacctggataggaagcccgtctatgggtgtgtcctctttccagtgt
tgtccctctgaggctgacatcccctccaagacaagaaagacatcccaggactgttcagga
gcaatccagtcaggaaagggcgacctgggcatggatgactctgggaatgtatctcctttg
cttgactcacctgctgaggaagccatgcacggattaaagaaggatggatctggagagcag
tttctttctgtcccatctcacttcacatggaacaaacccaaaccaggacacacacctatt
ttcagggcgtcatccctgcctcccctggactggccgttgccgaatcagtatgggcagtac
gagctaaagatcgaggttcaccccaaagctcatcaccgagctcattatgagaccgaaggc
agccgaggggccgtcaaagccacttctgggggacaccctgtcgtcaagctcgttggctac
aatgagaagccggtgaacctgcagatgttcatcgggacagcggatgaccgttatttgagg
ccgcacgcattctaccaggttcaccgcataacaggaaaaactgtcgctacggcaagccag
gaaattatcatcaccagcacaaaggttctggagattcctctccttcctgaaaacaatatg
tctgccagtattgattgcgctggaatcctgaagttgaggaactctgacattgagctgagg
aagggagaaactgatattggacggaaaaacactcgggtccgtgtggtgttccgggttcac
atcccacaacccaatggaaaagtggtctcactgcagactgtttcaattccagtggagtgc
tcccagcgctcagcacaggagttacctcaggtcgagaaagccagtattagcagttgccca
gtgagtggaggagaggaaatggtcatcattggttccaacttcttccccgagtcaaaggtc
atttttctggagaaaggtcctgatggacgaccgcagtgggaggtggaggcaaagatcatc
agagagaagagtcaaggatctagcatcatggtggaggtgcctccttatcacagtaagacg
gtcacttcagcagtgcaggtgcagttctatgtgtgcaatggcaaacggaaaaggagccag
tcacagcgctttacctatctgccagtccgggtcaagcaggaacatagagatgatctggac
tcccctgctgtgccgcccatgtccatgcctctggtccatgctgccagtttggtctgtact
cagccgctgtcctccccagagcactcccacccaccagacggccttctgtccagctcgcca
cgtggcctggctgcaggcctgcaccctctccaggccccctgcgccccaatgggctcccca
actcttccccacctgccccaccttcaggctcaagggctgaatgcacctcctgaatgccag
atgcccttccacccaggccctgctgccactgccaggctgtcttacccacccagcaatgtt
tga

KEGG   Sinocyclocheilus grahami: 107555722
Entry
107555722         CDS       T04918                                 

Definition
(RefSeq) nuclear factor of activated T-cells, cytoplasmic 3-like
  KO
K17333  nuclear factor of activated T-cells, cytoplasmic 3
Organism
sgh  Sinocyclocheilus grahami
Pathway
sgh04010  MAPK signaling pathway
sgh04218  Cellular senescence
sgh04310  Wnt signaling pathway
sgh04625  C-type lectin receptor signaling pathway
Brite
KEGG Orthology (KO) [BR:sgh00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    107555722
   04310 Wnt signaling pathway
    107555722
 09140 Cellular Processes
  09143 Cell growth and death
   04218 Cellular senescence
    107555722
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    107555722
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:sgh03000]
    107555722
Transcription factors [BR:sgh03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   RHR (Rel homology region) NF-AT
    107555722
SSDB
Motif
Pfam: RHD_dimer RHD_DNA_bind TIG DUF3304
Other DBs
NCBI-GeneID: 107555722
NCBI-ProteinID: XP_016094087
LinkDB
Position
Unknown
AA seq 1003 aa
MTTNYREELDFRLMFGESSYTQLPGHPESRSDDDATCYPLFPPGPHHPTEKQESCTNPSY
GTPHPGSLQPMESPSRVFDCPSIQITSIPANCHQDLGAHQLDQSAGACGEASAGSLSRDQ
LFLPLDASYRDTSSLCPSPCSSLSSRSWLSDASSCESFSHIYDDVEAELNEAAAQVRLAS
PLVSPLVSPLLSPLTSPQASPQVSPLVSPFGSPGCMAAYGDDPWYRYQQHHQQPLQYHCA
QSLSPYQSPRTSITEETWLSPRPHSSSSRPSSRPTSPCGKRRHSSAEVIPGSASPHLSPN
ITPSHSPRGSVTEETWMGGATFAPYQTFPLEVDIPSKTRRTYQTNHNQDQVALLPGQEDS
SLQDPGLANPSLNSGITMSLPSLKKEDMVEHFLAVPTHFPWVKPKQVSTPLYRSTSLPPL
DCPLPSQCGQCELKMEIQPKPHHRAHYETEGSRGAIKSDCGRHPVVKVRVCTRSQISQKK
KPVSLQMFIGTADERYPRPHPFYQVHRITGKTVATPSQETVISSTKVLEIPLLPENNMCT
SIDCAGILKLRNSDIELRKGETDIGRKNTRVRAVFRVHIPQHNGKVLSLQVASIPIECSQ
RLAQELPQIESFSPTCGSVNGGEEMLITGQNINPESTVVFQEKSSDGKTQWEVDVRALQE
KSQNTSIVVKIPPYYKKTTASSTQVQFYVSNGKRKRSASQFFTYLSAVQVKQEFGLRADL
NTNELGGQHPTTSQGGLFTTRDPLASDEVQPLEQWLLSEGTVCAPSSTHLSYSPQDPFYL
SRSHPAERSLNAEADLYPMFHPSLVDFNNSFYQKPQQDLSYKEQPSLPMVGGSLQGCKSS
QILAEQPRSQLDKGYQGIPTEHSQNLHNLGPVSVSNTSVLTSPNVDTSGLHTVDPVQFPQ
ASSSQVLPLSHQPTLAKVPSNSPSISESLMDPQPLGASLQEPSKSYSMSQDGERLQIKQE
PKEEKELAFQSIGLQDITLDDVSEIIVRDLFETPDSGSANSLL
NT seq 3012 nt   +upstreamnt  +downstreamnt
atgactactaactacagagaggagctggacttcagactgatgttcggggagagcagttac
actcagctgccgggccacccagaatccagatccgatgatgatgccacctgctaccctctc
tttcctcctgggcctcaccatcccacagaaaagcaggagagctgtacaaacccatcttat
ggcacccctcaccctggttccctccaacccatggagtctcccagccgggtatttgactgt
cctagcatccaaatcacctctatcccagccaactgccaccaggacctgggcgcgcaccag
ttggaccagtctgcaggtgcttgtggggaagccagtgctgggtctctgtcaagggaccag
ctcttcctgccattggatgcatcatatagggacacgtcctcactgtgtcccagcccctgc
agtagtttgtcctcccgcagctggttgtctgacgcctcatcctgtgaatccttctcacac
atctacgatgacgtggaggcagaattgaatgaggcagccgctcaagttcggctggcttct
cctctagtgtcgccactggtgtctcctctgctgtccccacttacttctccccaggcgtct
cctcaagtgtctccgcttgtctctccctttggttctccgggatgtatggctgcatatgga
gatgatccttggtaccgttaccaacaacatcatcagcaacctctacaataccattgcgcc
caatcgctgtcgccgtatcagtcaccccgcaccagcatcactgaggaaacgtggctcagt
ccccgtccacactcctcatcctcgcggccctcttctcggccaacctcgccatgtggaaaa
aggcgacattccagtgcagaggtcattcccggttcggcatctcctcacctttcccccaac
ataacaccatctcattctcctcgggggagtgtcactgaggaaacatggatgggaggcgcc
acatttgctccctaccagacctttccattggaggtagacatcccatccaaaacaagaaga
acgtatcagaccaaccacaaccaggatcaagtggctctgttgcctggacaagaggactca
agtcttcaagacccaggtcttgcaaatccatcgctaaactcaggcataaccatgtccctc
cccagtttaaagaaagaggatatggtggaacatttcttagccgtcccaacacacttccct
tgggttaagcccaaacaagtcagcactcctttatacaggtccacatctttacctccgctg
gactgccctctgcccagtcagtgtggccagtgtgagttaaagatggagatccaacctaaa
cctcaccacagagcccattatgagacggagggcagtcgcggggccattaaatcagactgc
ggaagacaccctgttgttaaggtcagagtttgcaccagatctcagattagccaaaaaaaa
aaacccgtcagcctgcagatgttcatcgggacagcggatgagcgttaccctaggccacac
ccattctatcaagtgcacaggattactgggaaaaccgtagcgacgccgagtcaagagaca
gtgatatccagcaccaaagttctcgaaattcctctcctgcctgaaaacaacatgtgtacc
agcattgactgtgctgggatcctgaagctacggaattcagacatcgagttgcggaaagga
gagacggatatcgggcgtaaaaacacacgtgtgcgtgctgtgttccgtgttcatatccct
caacacaatggaaaagtgctgtcactgcaggtggcgtccattcctatagaatgctctcaa
cgattagctcaggaacttccccaaatcgagagctttagtcccacctgtggttctgtgaat
ggaggagaagagatgcttataacaggccaaaacatcaatccagagtcaacagttgtcttc
caagaaaagagctctgatggtaaaacacaatgggaggtcgatgtgagggctttacaagaa
aagagtcaaaatacaagcatagtggtaaagattcctccgtactacaagaaaaccacggct
tcctccacccaggtgcagttctacgttagcaatggcaagaggaagagaagtgcctcacag
ttcttcacctatctttcagcagtgcaggtgaagcaggagtttggcttaagggcggacctt
aacaccaatgaacttggagggcagcatccgaccacctcccaaggaggtctcttcaccacc
agagacccgcttgcttcagatgaggtccagcctcttgagcagtggctgctgtccgaaggg
acagtttgtgctccttcttccacccatctcagttactcccctcaggatcctttctatctg
agccgctctcatccagcagaaagaagccttaatgctgaagcagacctctaccctatgttc
cacccttcattggtggatttcaacaactctttctaccaaaagcctcaacaggatctgtct
tacaaagaacaacctagtcttccaatggttggtggctcactgcaaggctgcaagtcatcc
caaatcttagcagagcaaccaaggtctcaactagacaaaggataccaaggcatacctaca
gaacacagtcaaaatctccacaaccttggtcctgtctctgtgtccaatacatccgtgcta
actagcccaaatgtggatacatccggtctgcacactgtggatcctgtgcaattcccacag
gcttcgtcttcccaggtacttcctctttcccatcagcctactcttgcaaaagtgccttct
aactcaccgtccatcagcgagagcttgatggaccctcagccattaggtgcatctcttcag
gagcccagcaaaagttacagtatgtcacaagatggagaacgccttcagattaaacaggaa
cccaaggaagagaaagagctagcctttcagtccataggcctgcaggatatcactcttgat
gatgtaagcgaaatcattgtaagagacttgttcgaaactccagattcagggagtgccaac
agtctgctataa

KEGG   Sinocyclocheilus grahami: 107557669
Entry
107557669         CDS       T04918                                 

Definition
(RefSeq) nuclear factor of activated T-cells, cytoplasmic 4-like isoform X1
  KO
K17334  nuclear factor of activated T-cells, cytoplasmic 4
Organism
sgh  Sinocyclocheilus grahami
Pathway
sgh04218  Cellular senescence
sgh04310  Wnt signaling pathway
sgh04625  C-type lectin receptor signaling pathway
Brite
KEGG Orthology (KO) [BR:sgh00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    107557669
 09140 Cellular Processes
  09143 Cell growth and death
   04218 Cellular senescence
    107557669
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    107557669
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:sgh03000]
    107557669
Transcription factors [BR:sgh03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   RHR (Rel homology region) NF-AT
    107557669
SSDB
Motif
Pfam: RHD_DNA_bind RHD_dimer TIG
Other DBs
NCBI-GeneID: 107557669
NCBI-ProteinID: XP_016096645
LinkDB
Position
Unknown
AA seq 869 aa
MGAAPGSGWEEGEFEFKLVFEEDPPRQSRRCGPEETESGQTHHEPAGTHLTSAQAGQPVG
IPPSAGRRAGMHSPPPRRALVREFSGTYESLPARSIQVSESRVLECPSIQITTISPEEDS
GPAGGSYWDGGGGWDRERLYMPLLDSYRDVMTGAGSLSPSPSPASSSSSRGWLSPASSCD
SLLMEEDELSEAAAHFCLLPSSRPTSPGGKKRRNSPLASPSTSRRSSYSEDPSSLPDTGE
TSAQSQAPASCELNIPQKTRKTSLEQMSSRDMEPELTLVQTSSCPLPDVAQLRREPPPLG
MDYLSVPPALGWGRTRASAHSPLFRSNALPPLDWPLPSQFDQYELRIEVQPRPHHRAHYE
TEGSRGAVKSSPGGHPVVKLVGYTERQPLSLQVFVGTADDRSIRPHPFYQIHRVTGKMVG
TASQESIQAGTKLLDIPLNPENNMTALIDCAGILKLRNSDIELRKGETDVGRKNTRVRLV
FRTHLPLSPPIIPPGRVLALQVASLPIECSQRSAQELPVVESISLTSCSAEGGEELLLGG
TNFLPTSRVFFMERGSDGKVQWEEEAHVDKSNENLLCVQVPAYNELSLNHPVSVCLYVSN
GKRKRSSTHCFKYLPIMFKEEDPLLSRPSSLPLEGVTLCPMGNGSTVDMRSDLSADDRSM
SFHLPPYPNEYSYSSHGYQEDYWRKPEVTEDGGGRGALTERHPSFESLELGFTELLPPMY
PRASQPLSSSPSPSPWLDSPYLSSSPSPSHSCSLSPFPASSPISTSPLPPLSHSPYPHCP
CPQEMCSSPPSNTSHYQDLCPPPYWQYESWEHQMHPAERDTGPSLKLEGPPNITGPSPMQ
HITLEEVTEFIGEDIRSFQMGTHMDSRPG
NT seq 2610 nt   +upstreamnt  +downstreamnt
atgggggccgcgccgggctcgggatgggaggagggagagttcgagttcaagctcgtgttc
gaggaggatccgccgcgccagagccgccgctgcggcccagaagagaccgagagcggccag
acgcaccatgagccagccggtacccacttgacttccgcacaggctggccaacccgtgggt
atcccaccgtcagccggtcgcagggctgggatgcattccccaccccccaggcgggcatta
gtcagggagttcagtgggacttatgagagtctgccagcaagatcaatacaggtatcagag
tctagagtgcttgagtgccccagcatccagatcaccactatctcccctgaagaggactca
ggtccagcagggggaagttactgggacggcgggggtggctgggacagggagcgtctatac
atgcccctgctggactcttaccgtgacgtcatgacaggggcaggttccctcagtcccagc
cccagccctgcttccagttcctcatctcgtggatggctgagtccagcttccagctgtgat
tctctcctgatggaggaggacgagctcagtgaagctgctgcccacttctgcctattgccc
tcctcgcgtcccacgtctcctgggggcaaaaagcgcaggaactccccactggcctccccc
agcacctcccgcagaagcagctactccgaagatccctcctccctcccagacacgggagaa
acctcggctcagtctcaagctccagcgagctgtgaactcaacatcccacaaaagaccagg
aagacctctctggaacagatgtcatcaagagatatggaaccagagctgaccctcgttcag
acctcttcctgccccctcccagatgttgctcagctgagaagggagcctcccccactaggg
atggactacctgtctgtgcctcctgctctgggctggggcagaaccagggccagcgctcac
agtcctctctttagatctaatgcactgccgccacttgactggccgctgccttcacagttt
gaccagtatgaactgcgcatagaggtacagcccagaccacaccatcgcgctcattatgaa
actgaaggaagtcgaggagcagtaaagtcatcacctggaggccatccagtagtgaagctt
gtaggttatactgagagacagccactttccttacaggtgtttgtaggaactgctgatgac
agatcaatacgtcctcatcctttttatcaaatacacagagtaacagggaagatggttggc
acagctagtcaggagagcatccaggctggcaccaaactcctggacatcccactcaatcca
gagaacaacatgactgccctcattgactgtgcaggtattctaaagctgaggaactctgac
attgaactccggaaaggagagacagatgtagggagaaagaacactcgcgtgcgtttggtg
ttccgcacacaccttcctctgtctccacccatcattcccccaggacgagtcttagcgctg
caggtggcgtctttacccattgaatgctcacagcgctctgcacaggagcttcctgtagtg
gagtctatcagtcttacttcttgttcagcagagggaggcgaggaactacttctaggtggg
accaactttctacccacctccagagttttctttatggagagaggatcagatggcaaagtc
cagtgggaggaggaggcacatgtggacaaaagcaatgagaatttgctatgtgtacaggtg
ccagcctataacgaactttcactgaaccacccagtatctgtctgcctgtatgtgtccaat
gggaagaggaagaggagcagcacacattgctttaaatatctgcccatcatgtttaaagag
gaagatccgctgctgtcccgtccctctagcttgcccctggaaggggtgacgctttgcccc
atggggaacggcagcactgttgacatgaggtcagacctatctgcagatgacagaagcatg
tctttccacctgcctccatatcccaatgagtactcttactcctcgcatggctaccaggag
gactactggcgtaaaccagaggttaccgaggatggtggaggtcgaggtgccctgaccgaa
aggcatcccagctttgagagcctggagctgggcttcacggagcttcttcctcccatgtac
ccaagagcctcacaacctctttcctcctccccatctccctctccgtggcttgactctccc
tatctgtcctcctcaccttctccctctcactcttgctctctgagcccattccctgccagc
agtccgatctcaacctcgccccttcctcctctctctcactccccatatccacactgtcct
tgcccccaagagatgtgttcctcacctccatcaaacactagccactatcaggacctgtgc
ccacctccatactggcaatacgagagctgggagcaccagatgcatcccgctgaaagagac
acaggccccagtctgaagttggagggacccccgaacatcacgggcccttcaccgatgcag
cacatcacactagaggaagtgactgaattcattggagaggatataagatcctttcagatg
gggacacacatggacagtcgacctggatga

KEGG   Sinocyclocheilus grahami: 107558753
Entry
107558753         CDS       T04918                                 

Definition
(RefSeq) nuclear factor of activated T-cells, cytoplasmic 2-like isoform X1
  KO
K17332  nuclear factor of activated T-cells, cytoplasmic 2
Organism
sgh  Sinocyclocheilus grahami
Pathway
sgh04218  Cellular senescence
sgh04310  Wnt signaling pathway
sgh04370  VEGF signaling pathway
sgh04625  C-type lectin receptor signaling pathway
Brite
KEGG Orthology (KO) [BR:sgh00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    107558753
   04370 VEGF signaling pathway
    107558753
 09140 Cellular Processes
  09143 Cell growth and death
   04218 Cellular senescence
    107558753
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    107558753
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:sgh03000]
    107558753
Transcription factors [BR:sgh03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   RHR (Rel homology region) NF-AT
    107558753
SSDB
Motif
Pfam: RHD_dimer RHD_DNA_bind TIG
Other DBs
NCBI-GeneID: 107558753
NCBI-ProteinID: XP_016097913
LinkDB
Position
Unknown
AA seq 653 aa
MNSFYDDKAALGLAEECQDELEFDYLFEYGSTTGLQDEQSISSHKDLISPPSLPYPVEEA
QPYGIKPCAASFAELSAEGLSGYAQLEPKSFLESARPNSQALSPRIEITPSREHYSHGRD
SLQNHLVNISASPGLTVPGHDPLAYREPQCLSPASSNSSTSWHSENLSPWASPCVSPSNS
QVAGELCPRLQGVHTGSPRTSPGTSPQSSLAEDGCVGPRSPSPRPGSRSTSPLCKRTYDM
YRNLVPVARSRSPSPHGGHEEHHTPHYGSNNISGVMNGFGVAQASFIPTKIVKTNPQAYS
LYPENHTESYLVSCDQDVKTKPGPEPFFVIPQIWPKQLVPGICSIPVASLPLLEWPLPSR
TDQYELHIEVQPKPHHRAHYETEGSRGAVKAPTGGHPVVQLRGYRGKEPLGLQIFIGTAD
ERILKPHAFYQVHRITGKTVTTTSYEKIISSTKVLEIPLEPKHNMKAIIDCAGILKLRNA
DIELRKGETDIGRKNTRVRLVFRVHVPQQGGQHVSLQVASHPIECSQRSAHELPMVEKQD
MDACSVLGGQQMILTGQNFSADSKVLFMEKTHDGQQIWELEATVDKDKSQASMLFIEVPP
YRDPSICNPAKVNFYVINGKRKRSQPQHFTYTPLPVNEIIRKDLTGVPGRGET
NT seq 1962 nt   +upstreamnt  +downstreamnt
atgaactctttttacgacgacaaggctgcgttaggactggctgaggagtgtcaggatgag
ctggagttcgactatctgtttgagtatggaagcacaacggggcttcaagatgagcaaagc
atctcctcgcacaaagacctcatctctcctcccagcctcccctatcctgtggaggaagct
caaccgtacggcatcaagccgtgtgcggcttccttcgccgaactcagcgccgaaggtctc
tcaggctacgctcaactggagcccaagagcttcctggagagcgccagacccaacagccaa
gcgctgagccctcggatcgagatcacaccctccagagagcactatagtcatggtcgagac
tcgctccagaaccatctggtgaacatcagcgccagtcccggtctcaccgtgcccggtcac
gaccctctggcctatagggagccacagtgcttgagtcccgccagcagcaactcatccacc
tcctggcattcggagaacctctcgccctgggcttccccttgcgtttcacccagcaacagc
caagtggctggagaactttgccctcgactccagggcgtccacacgggttcccctcgaacc
agtccgggaacttctccgcaaagcagcctggccgaggacggctgcgtggggccgcgctct
ccttcgccccggcccggctcgcgctccacctcccctctatgcaaacgcacctacgacatg
tacagaaacctggtgccggtggcccgttcgcgcagcccgtctcctcacggtggccacgaa
gagcatcacaccccccattatggctccaataacatctcaggggtcatgaatgggttcggc
gtcgcccaagctagtttcattcctaccaaaatcgtgaagacaaacccacaggcctactcg
ctttacccagagaaccacactgagagttacctggtgtcatgtgaccaggatgtgaagacc
aaacctggccctgaaccgttcttcgtaatccctcaaatctggcctaaacagctggtgccg
ggaatatgcagcatccctgtggcttccctgccgctgctggagtggcctctgcccagccgc
accgatcagtacgagctccacatcgaggtgcagcccaaaccgcaccacagagctcattat
gagaccgagggcagccgcggggcagtcaaagcccctactggaggtcacccggtggtccag
ttacgtggataccgaggcaaggagccgctgggattgcagatcttcattggcacggcagac
gagcgcatcctgaagcctcacgctttctatcaggtccatcgcattaccggcaaaaccgtc
accaccaccagctacgagaagatcatcagcagcaccaaagtcctggagattcctctcgag
ccaaagcataatatgaaagcaataatcgattgcgccgggattcttaagcttcgcaatgcc
gacatcgagctgcgaaaaggagagaccgacatcgggcggaaaaacacacgtgttcggctg
gttttccgtgttcatgttccccagcaaggaggccaacatgtgtctctgcaagttgcttcg
catcccatcgaatgctcccagaggtctgcccacgagctgcccatggtggaaaagcaggac
atggacgcctgttcggttctcggaggccagcagatgattctcaccggccagaacttcagc
gcagattcaaaggtgctcttcatggagaagactcatgatggacagcaaatttgggaattg
gaagccacagttgacaaagacaaaagtcaggcaagcatgctgttcattgaagtgcctcca
tatagagacccatccatttgcaatcctgccaaagtcaacttttatgtaataaatgggaaa
cggaagcgcagtcaaccgcaacatttcacctacacgcctctaccagtgaatgagatcata
aggaaggatctgacaggagtgcctggcaggggtgagacatag

KEGG   Sinocyclocheilus grahami: 107560498
Entry
107560498         CDS       T04918                                 

Definition
(RefSeq) nuclear factor of activated T-cells, cytoplasmic 1-like
  KO
K17332  nuclear factor of activated T-cells, cytoplasmic 2
Organism
sgh  Sinocyclocheilus grahami
Pathway
sgh04218  Cellular senescence
sgh04310  Wnt signaling pathway
sgh04370  VEGF signaling pathway
sgh04625  C-type lectin receptor signaling pathway
Brite
KEGG Orthology (KO) [BR:sgh00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    107560498
   04370 VEGF signaling pathway
    107560498
 09140 Cellular Processes
  09143 Cell growth and death
   04218 Cellular senescence
    107560498
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    107560498
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:sgh03000]
    107560498
Transcription factors [BR:sgh03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   RHR (Rel homology region) NF-AT
    107560498
SSDB
Motif
Pfam: RHD_DNA_bind RHD_dimer MADF_DNA_bdg TIG
Other DBs
NCBI-GeneID: 107560498
NCBI-ProteinID: XP_016100183
LinkDB
Position
Unknown
AA seq 914 aa
MSNLYENIDGQEELDFPLLFLYNQPDLPPDDQVDDAGIPSSHGTNQTSLYDEESACQLSH
HLPTDDLLTYGQSDYRHPSMLASHPGALQGNGPRIEITCPDLYQHDHVHTNPVNISQPML
DIPYRENQCLSPASSTSSTSWHSDGCSPGTYSPCISPGVSEGTLAGLTEAVLCPMMQAIQ
ASGSPNTSPRTSITEDTVLDRRPTSPRSRSASPQGKRTYAEYETQRSQSPRFGRDKPAEF
YPLADLEDSMNSLSHSLAKPIPTKIVRPNLEYSVYTESHVGMFPPMPEVKKEFAVEPCYF
MHANWSSQALTGVCSMPVAALPAPEWPLPSSTEQYELRIEVQPRQHHRAHYETEGSRGAI
KASTGGHPVVQLRGYTGTEPLALQVFIGTADDRNLRPHAFYQVHRITGKTVSTNSQERML
NGTKVLEVPLEPKENMRAVVDCAGILKLRNADIELKKGETDVGRKNTRVRLVFRVHVPQP
SGQWISLQVASQTIECSQRSAHEQPVVDHHDLDHCSVLGGPQMILRGQNFTSESKVIFFE
KTHVDLQLWEAEAKVYRDKCTSNLLFLEIPPYREPNIYHPVKVKFHVLNGKKRCSQPQNF
TYTPLSVPQIKAEPVEEYQYAQLGCTGHPIMGISPPSYHLADGCMMPGGPSYQRAHCMYP
AAPQHAPMRYPLDHTVPGLFTGSTAHAAGHATSVSTFVPNTFQHTVAGDSFQTAASLFPT
LDVSELCSVAAHQKAYGSRASPTTGRSPPARIHQQTYLPLQHQRNVSPVRVTIKQENLDQ
AYLDDEQILVELWQQRACLYDVSSSCYHDRTKKDIAWKEIAEELQLPSSLCKTGIPSCPL
FPSHERVHIALFRRRLFFVSAHMKSTTAKARSIYDSIGVIIAYGAITCMPQKAIIVMEKH
LKISNFKNCCFRKT
NT seq 2745 nt   +upstreamnt  +downstreamnt
atgagtaatttatacgaaaacatcgacggtcaagaagaactggactttccattacttttc
ctgtacaaccaacctgacttacctccagatgaccaagttgatgacgctggcatcccctcc
agccatggtaccaatcaaacttctctgtacgatgaggagtctgcgtgccagctttcccac
catctccctaccgatgaccttctcacctatgggcaatctgattatagacacccctctatg
cttgccagccaccctggagcgctccaaggcaacggcccgagaattgagatcacctgccct
gacctgtaccagcatgaccatgtccacaccaaccctgtgaacataagtcagcccatgctt
gacatcccttacagggagaaccaatgcctcagtccggctagtagcacctcgtctactagc
tggcattcagatggctgttctcctggaacatactccccctgcatctctcccggtgttagt
gaaggaacgctagccggattgaccgaagccgtcctttgcccgatgatgcaggccatccaa
gcttctggttctcccaacacgtcccctcgcaccagcatcacagaagacaccgtcctggac
cgccgtcccacctctccacgttcccgctcggcttctccgcaggggaagcgcacttacgcc
gaatacgagacacagagatctcaaagcccccgttttggccgggacaagcccgctgagttc
tatccactggcagacttggaggattccatgaacagcctcagccacagcttggctaaacca
atccctactaagattgtccgacctaatctagagtattctgtctacacggaaagccatgtg
ggcatgttcccacctatgccggaagtgaaaaaagaatttgctgtagaaccgtgctatttc
atgcatgccaactggtccagtcaggctctcacaggggtttgtagtatgccagtggctgcc
ttgcctgcgcctgaatggcctcttcccagcagcactgagcagtatgagctcaggatagag
gttcaacccagacaacaccaccgggcccactacgagacagagggcagccgaggggccatc
aaagcatctactggaggccatcctgtcgttcagttgcgagggtacaccgggactgagccg
ctggctctacaggtcttcatcggcacggctgacgacaggaacctcagacctcacgccttc
taccaggtccaccgtatcaccggcaagaccgtctctaccaacagtcaagaacgaatgctg
aacggaaccaaggtcctagaggtgccactggaacccaaggagaacatgagagctgtagtt
gactgcgctggtatcctgaaactgagaaatgccgacattgagctgaagaaaggagagaca
gatgtgggacggaaaaacacacgagtgagattggtcttccgtgtccacgttcctcaaccc
agcggccagtggatctctctccaagtggcttcgcagactattgaatgctctcaaaggtct
gctcacgagcagccagtggtagatcatcatgacttggaccactgttcggttctgggtgga
ccgcagatgatccttaggggccaaaacttcacatcagagtccaaagtcatcttctttgag
aaaacgcatgttgacttacagttatgggaggctgaggcaaaagtttacagagacaaatgc
acatctaacctgctgtttttggaaatccctccatatcgagaacccaatatctaccaccca
gtcaaagtcaaatttcacgtactgaatgggaagaagagatgcagccagcctcaaaacttc
acctacacgcccctctcagtgccacagattaaagcagagccggttgaagaataccaatac
gcacagttaggctgtactgggcatcctattatgggtatctctcctccctcttaccatctt
gcagacggttgcatgatgccgggtggcccgtcataccagcgggctcactgcatgtaccct
gctgccccacaacacgcacccatgcgctacccgctggatcacacggtgccaggacttttc
accggctccacggctcacgcagcaggtcacgcaacctctgtgtctacatttgtgcccaac
accttccagcacaccgtagcgggagacagcttccaaacggccgcctctctgtttcccact
ctcgatgtctcagagctctgctccgtcgcggcccatcagaaggcatacggctcgagggcg
tccccaaccacagggagatcacctccggcccgtatccatcagcagacatacctgccattg
cagcaccagagaaacgtcagtcctgtgagagtcaccatcaagcaggagaacctggatcag
gcctatctggatgatgaacaaattcttgttgagttgtggcagcagagggcatgtttgtac
gatgtgtcctctagctgctatcatgaccgcacaaaaaaggacatagcatggaaggagatc
gcggaggaactgcagctgccaagctccctgtgcaaaactggcatcccaagttgtcctctt
ttcccgagccatgagagggtccatattgccctcttccgccggcgcctcttctttgtttca
gcgcacatgaaaagcacaactgccaaagcgcgatccatctacgattcaataggtgtcatc
atcgcctacggtgcaataacgtgtatgccccaaaaagccatcatagtcatggaaaaacat
ctgaagatatccaacttcaagaactgctgtttcagaaagacctga

KEGG   Sinocyclocheilus grahami: 107563458
Entry
107563458         CDS       T04918                                 

Definition
(RefSeq) nuclear factor of activated T-cells, cytoplasmic 3-like isoform X1
  KO
K17333  nuclear factor of activated T-cells, cytoplasmic 3
Organism
sgh  Sinocyclocheilus grahami
Pathway
sgh04010  MAPK signaling pathway
sgh04218  Cellular senescence
sgh04310  Wnt signaling pathway
sgh04625  C-type lectin receptor signaling pathway
Brite
KEGG Orthology (KO) [BR:sgh00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    107563458
   04310 Wnt signaling pathway
    107563458
 09140 Cellular Processes
  09143 Cell growth and death
   04218 Cellular senescence
    107563458
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    107563458
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:sgh03000]
    107563458
Transcription factors [BR:sgh03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   RHR (Rel homology region) NF-AT
    107563458
SSDB
Motif
Pfam: RHD_dimer RHD_DNA_bind TIG DUF3304
Other DBs
NCBI-GeneID: 107563458
NCBI-ProteinID: XP_016103832
LinkDB
Position
Unknown
AA seq 1072 aa
MTTANCPGNEELDFRLIFGEDGQQPPLGPADLETDENTSFYVLNVGQPPSVVNQSYGLQR
HGGPAQLIATSPSLQAHHKAYEPSYEPQDSKYTHTGVGGGGHGPPKAFECPSIQITSISP
SCQQEMEASEDEMRAKGPDRDYHNRPLSRDHLYLPLDHSYRDSSLSPSPCSSLSSRSWFS
DASSCESISHVYDDVDSELNEAAARFTLGSPLTSPGCSPQTGPHEEVWQQQHHHHHPAFI
HSLSHSHGHSLSPRQSPCHSPRTSITDENWLNPRSPSRPSSRPTSPCGKRRHSSADICYL
GSLSPHHSPTATPGPSPRGSVTEDTWIGSPSMGVSPFQCCPSEADIPSKTRKTSQDCTAA
IQSGKGDLGMDDSGNVSPLLDSPAEDGMHGLKKDGSGEQFLSVPSHFTWNKPKPGHTPIF
RASSLPPLDWPLPNQYGQYELKVEVHPKTHHRAHYETEGSRGAIKAASGGHPIVKLVGYN
EKPVNLQMFIGTADDRYLRPHAFYQVHRITGKTVATASQEIIIASTKVLEIPLLPENNMS
ASIDCAGILKLRNSDIELRKGETDIGRKNTRVRVVFRVHIPQPNGKVVSLQAASIPVECS
QRSAQELPQVEKASISSCSVSGGEEMVITGSNFFPESKVIFLEKGPDGRPQWEVEAKIIR
EKSQGSSIVVEVPPYHSKTVTSVVQVQFYVCNGKRKRSQSQRFTYLPVRVKQEHRDDLDS
PAVPPMSMPLVHAASLVCAQPLSSPEHSHPPDGLLSSSPRGLAAGLHPLQAPCAPMGSPT
LPHLPHLQAQGLNAPPECQMPFHPGPAATARPSYPPIQHNMPFNGQHSLPMTTGSPQAYE
RIPFQADPAGCHSLGLGMVYGPASSTPTSGVPPGPGSSPSHAACTGSNQVMAHSAPHHHS
LGYHCPAPGQVPSPTHTLGQPAPQLQHPLVYHPAGQRSASCPTPSSAPVHMVPSPHSGPS
SPQLHSLPYHSPTSPSPTSNSPLGPMGLSGQPSPQACSPVLAGLSPAGPLVHPLTQQGER
LNIKQEPEDREPTFRTIGLQDITLDDVNEIIGRDMSQAPEAHGGSPAAHSQS
NT seq 3219 nt   +upstreamnt  +downstreamnt
atgactactgcaaactgccccgggaatgaagagctggacttcagattgatctttggagaa
gacgggcagcagccgccgctaggccccgcagatctagaaacagatgaaaacacatcattt
tacgtcctcaatgtgggacaacctccttcagtggtgaaccaatcatacggtctccagcgg
catggaggcccagcccaactcattgccacctccccatccctgcaggcccaccacaaggcc
tatgagcccagctacgagccccaggactctaaatacacgcacacaggggtgggcggagga
ggccatggcccacctaaggcttttgaatgtcccagcatccagatcacctcaatctccccg
agctgccagcaggagatggaggccagcgaggatgagatgagagcgaagggtccggataga
gactaccacaacagacctctgtctcgagaccacctgtacctgcctctagatcactcgtat
cgagattcatccctgagcccgagtccatgtagcagcctttcctctcgtagctggttctcc
gacgcatcgtcctgcgaatccatctcacacgtgtacgatgacgtggattcagagctaaat
gaagcagcggcacgtttcaccctgggctcgccgctgacctcgcctggctgctctccacag
actggaccacatgaggaagtgtggcaacagcagcatcaccatcatcacccggccttcatt
cactccctttctcattcgcatggccattctctctcaccccgccagtcgccttgccactcg
ccccgtaccagcatcacagatgagaactggctgaaccctcgctcaccctcacggccctct
tcacgtccgacatcaccctgcgggaagagacgccactccagcgctgatatatgctacctg
ggctctttatcaccccatcactccccgactgccacgcccggcccctcgcccagggggagc
gtgactgaagacacctggataggaagcccatctatgggtgtatcccctttccagtgttgt
ccctctgaggctgacatcccctccaagacgagaaagacctcccaggactgtacagcagca
atccagtcaggaaagggtgacctgggcatggatgactctgggaatgtgtctcctttgctt
gactcacctgctgaggacggcatgcacggattaaagaaggatggatctggagagcagttt
ctttctgtcccatctcacttcacatggaacaaacccaaaccaggacacacacctattttc
agggcgtcatccctgcctcccctggactggccgttgccgaatcagtacgggcagtatgag
ctaaaggtcgaggttcaccccaaaactcatcacagagctcattacgagaccgaaggcagc
cgaggggccatcaaagccgcatccgggggacaccctatcgtcaagcttgttggctacaat
gagaagccagtgaacctgcagatgttcatcgggacagcggatgaccgttatttgaggccg
cacgcgttctaccaggttcaccgcataacaggaaaaactgtcgctacggcaagccaggaa
attatcatcgccagcacgaaggttctcgagattcctctccttcctgaaaacaatatgtct
gccagtattgattgtgctggaatcctgaagttgaggaactctgacattgagctgaggaaa
ggagagactgatattggacggaaaaacactcgggtccgtgtggtgttccgagttcacatc
ccacaacccaatggaaaagtggtctcactgcaggctgcttcaattccagtggagtgctcc
cagcgctcagcacaggagttacctcaggtcgagaaggccagcattagcagctgctcagtg
agtggaggagaggaaatggtcatcactggctccaacttcttccctgagtcaaaggtcatt
tttttggagaaaggtcctgatggacgaccacagtgggaggtggaggcgaagatcatcaga
gagaagagtcaaggatctagcatcgtggtggaggtgcctccttatcacagtaagacggtc
acttcagtggtgcaggtgcagttctacgtgtgcaatggcaaacggaaaaggagccagtca
cagcgctttacctatcttcctgtacgggtcaagcaggaacatagggatgatttggactcc
cctgccgtgccgcccatgtccatgcctcttgtccatgctgccagtttggtctgtgctcag
ccgctgtcctccccagagcactcccacccaccagacggccttctgtccagctccccacgt
ggcctggctgcaggcctgcaccctctccaggccccctgcgccccaatgggctccccaact
cttccccacctgccccaccttcaggctcaagggctgaatgcacctcctgaatgccagatg
cccttccacccaggccctgctgccactgccaggccgtcttacccacccatacagcacaac
atgcccttcaacggccagcacagtcttcctatgactacgggctccccacaggcatatgag
cgaatacccttccaggccgacccggctgggtgtcactccctgggtttggggatggtgtat
ggaccggcttcttcgacacccacctctggagtgcctccggggcctggctctagccctagc
cacgcagcctgtacaggtagcaaccaggtcatggcccactctgcccctcaccatcactcg
ctaggctaccactgccccgctccagggcaggtcccatcacccacccacacattgggacag
ccggccccacagctccagcatcccctggtttaccatccggccgggcagcggtctgcctcc
tgtcccacaccctccagtgctcctgttcatatggtgccatctccccactctgggccctcg
tccccccaactccattccctcccttaccactcacccacctccccgtctcctacatccaac
agccccctggggcccatgggactctctggacagccttctccacaggcctgcagccctgtc
ctggctgggttgtcccctgcaggtcccttggtgcacccattgacccaacagggagagagg
ctgaacatcaaacaggagccagaggatagagagcccaccttccgtaccatcggtctacag
gatattacgcttgacgatgtgaatgagatcataggcagagacatgtctcaggccccagag
gctcatgggggctcgccagctgcacacagtcagtcctag

KEGG   Sinocyclocheilus grahami: 107563708
Entry
107563708         CDS       T04918                                 

Definition
(RefSeq) nuclear factor of activated T-cells, cytoplasmic 1-like
  KO
K04446  nuclear factor of activated T-cells, cytoplasmic 1
Organism
sgh  Sinocyclocheilus grahami
Pathway
sgh04010  MAPK signaling pathway
sgh04218  Cellular senescence
sgh04310  Wnt signaling pathway
sgh04625  C-type lectin receptor signaling pathway
Brite
KEGG Orthology (KO) [BR:sgh00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    107563708
   04310 Wnt signaling pathway
    107563708
 09140 Cellular Processes
  09143 Cell growth and death
   04218 Cellular senescence
    107563708
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    107563708
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:sgh03000]
    107563708
Transcription factors [BR:sgh03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   RHR (Rel homology region) NF-AT
    107563708
SSDB
Motif
Pfam: RHD_dimer RHD_DNA_bind TIG
Other DBs
NCBI-GeneID: 107563708
NCBI-ProteinID: XP_016104141
LinkDB
Position
Unknown
AA seq 752 aa
MKSAEEDAYGYSQNNSISLALSNPCPTSQYHNLQTSPSMSISISQPSSFSPQDDMRSVGY
FQTSGTRSNGAPTLESPRIEITAYGQFPEDEVEENSVPVTKRVNSIVTLTLPSIDGYRDP
TCLSPASSMSSRSCHSDASSYESGFSYNYDNSPQNSPWQSPCVSPKGSSSLQSCTLGASP
RHSPSGSPRTSITDDSWMGTRGSRPNSPCGGKRKYSFNGGPSHKYHPHSPNQSPGLSPHT
SPRLSVTEDNWLPNTNQYTNSAIVAAINALTTDGIADLGEGIPLKSRKTSLEHSASMNLK
VEPGGEETGSLELCQEDFSSARLPFKKETYCSGFLDVPQHPYWSKPKPYISPSLPALDWQ
LPSSSGPYSLQIEVQPKSHHRAHYETEGSRGAVKALAGGHPVVQLHGYMESEPLTLQLFI
GTADDRLLRPHAFYQVHRITGKTVSTPSHEVIQSNAKVLEIPLLPESNMRAIIDCAGILK
LRNSDIELRKGETDIGRKNTRVKMVFRAHINQPNGRMVSLQVASNPIECSQRSAQELPLV
DKQSMESCAASGGEQMFLSGHNFQPDSKVVFVERAQDGHHIWEMEAKVNRESSKSVALLV
DVPPYRNQRISSPVQVNFYVCNGKRKRSQYQRFTYLPTNVPTIKTEPHDDYDLPQVCAPL
HSAGLVLHPKPYYSPPAMTPMMPSELRPCVMGSFTSSPQRLVAKPTSLSCSSSPSTSPKL
QDLSPPHLSTKCISAGSNLGPQSPTSTICILV
NT seq 2259 nt   +upstreamnt  +downstreamnt
atgaaatccgcagaggaagatgcatatggttacagccaaaacaacagcatctcactagct
ctgagcaacccctgcccaacctcccagtaccacaatctccagaccagcccttccatgtcg
atatccatcagtcagccatcctcattctcccctcaagatgacatgagatcagtgggttat
ttccaaacatccggcaccaggtccaatggagctcccacattggaaagtccacgcattgag
ataacagcttacgggcagttccccgaggacgaagtggaggagaacagcgttcccgtgacc
aagcgagtcaattccatagtgacattaactttgccaagcattgacggttatcgtgacccc
acttgcctcagcccggcgagcagcatgtcttcccgtagctgccattcagatgcatcttcg
tacgaatcaggcttctcgtacaactacgacaactcgccgcagaactcgccctggcagtct
ccctgtgtctccccgaaaggttcctcatctctgcagtcttgcacacttggtgcttctcca
cgtcattctccctccggttctccccgtaccagtataaccgacgacagctggatgggcacc
cgaggctcacgaccgaattctccttgtggtggtaaacggaagtacagcttcaacggtggc
ccatcgcacaagtaccatccgcactcgccaaatcaatccccggggctgtcgccacacact
tcgccccgtctcagcgtgacggaggacaactggctgcccaacaccaatcagtacaccaac
tctgccattgttgccgccattaatgccctcaccacagatggaatagcagatcttggggag
gggatccctttgaagtcccgcaagaccagtctggagcacagcgcctcgatgaacctgaaa
gtagaaccaggtggagaggagacaggatccctggagctttgccaggaggacttctcctca
gcacgcctgcccttcaaaaaagagacctactgcagcggcttcttggatgtgccccaacac
ccatattggtccaagcccaagccttacatcagtccatcgttgcctgctcttgattggcag
ttgccttccagttcagggccgtacagcctgcagattgaggtccaacccaagtcccatcac
cgtgctcactacgagactgaaggcagcagaggggccgtaaaagcactagcgggagggcat
ccagtggtccagcttcatggctacatggagagtgagcctctgaccctacagctgtttatt
gggacagcagacgaccgtcttctccggccccacgccttctaccaggtccaccgtataacc
gggaagaccgtgtccacaccaagccacgaggtcatacagtccaacgccaaagttcttgag
attcctctattgcctgagagcaacatgagggccataatcgactgcgctggaattctcaag
ctgcgtaactcagacatcgagctccggaagggcgagacagacatcggacggaagaacacg
cgtgtgaagatggtgttccgtgcccacatcaaccaacctaatggcaggatggtgtcctta
caggtggcatctaaccccattgagtgctcccagcgctcagcacaggagctgcccctcgtg
gataaacagagcatggaaagctgtgccgcctcagggggggaacagatgtttctcagtggg
cacaacttccagcccgactccaaggtggtgtttgtggagcgagcacaagatggccatcac
atatgggaaatggaggccaaagtcaacagagaatcatccaaatctgtggctttgcttgtg
gacgtcccaccgtaccggaatcaaagaatatccagtccagttcaagtgaatttctatgtg
tgcaatggcaaacggaagagaagccagtaccagcgtttcacatacctgcccacaaacgtt
ccaaccataaaaacagagccgcacgatgactacgacctcccccaggtttgtgcgccgctc
cattccgccgggttggtgcttcatccgaagccctactacagccccccggcaatgaccccc
atgatgccctcagaactaaggccttgtgtcatgggctcattcacatcgagccctcagaga
ctggtggcaaagcccacctccctgtcctgctcttcctcccccagcaccagccccaaacta
caggatctttccccacctcacctctccactaagtgtatatcagcaggatcgaacctaggc
ccccagtctccaacgagcaccatttgcatactcgtttaa

KEGG   Sinocyclocheilus grahami: 107566268
Entry
107566268         CDS       T04918                                 

Definition
(RefSeq) nuclear factor of activated T-cells, cytoplasmic 3-like
  KO
K17333  nuclear factor of activated T-cells, cytoplasmic 3
Organism
sgh  Sinocyclocheilus grahami
Pathway
sgh04010  MAPK signaling pathway
sgh04218  Cellular senescence
sgh04310  Wnt signaling pathway
sgh04625  C-type lectin receptor signaling pathway
Brite
KEGG Orthology (KO) [BR:sgh00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    107566268
   04310 Wnt signaling pathway
    107566268
 09140 Cellular Processes
  09143 Cell growth and death
   04218 Cellular senescence
    107566268
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    107566268
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:sgh03000]
    107566268
Transcription factors [BR:sgh03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   RHR (Rel homology region) NF-AT
    107566268
SSDB
Motif
Pfam: RHD_DNA_bind RHD_dimer TIG DUF3304
Other DBs
NCBI-GeneID: 107566268
NCBI-ProteinID: XP_016107145
UniProt: A0A672LVH3
LinkDB
Position
Unknown
AA seq 990 aa
MTTNYREELDFRLMFGESSYPSSPGHAESRSDDDANCYPLFPPGPHHPPEQQDSYANQSY
GTPHPGSLQPMESPSRVFDCPSIQITSITANCHQDLGAHQLDELAGACGEAGAGSLSRDQ
LFLPLDASYRDTSSLCPSPCSSLSSRSWLSDASSCESFSHIYDDVEAELNEAAAQVQLSS
PLVSPLASPLPSPLTSPQASPQVSPLVSPFGSPLAAYGDDPWYRYQQHHQQPLQYHYAQS
LSPYQSPRTSITEETWLSPRPQSSSSRPSSRPTSPCGKRRHSSAEVIPGLASPHLSPNVT
PSHSPRGSVTEETWMGGATFAPYQTPPLEVDIPSKTRRTYQTNHNQHQVALLPEGSSLQD
PGLANPSLNSGIAVSLPSLKKEDIVEHFLAVPTHPWVRSKQVSTPLYRSTSLPPLDSPLP
NQCGQCELKIEIQPKPHHRAHYETEGSRGAIKSDCGRHPVVKLTGYNEKPVSLQMFIGTA
DERYIRPHLFYQVHRITGKTVATPSQETVISCTKVLEIPLLPENNMCASIDCAGILKLRN
SDIELRKGETDIGRKNTRVRAVFRVHIPQHNGKVLSLQVASMPIECSQRLAQELPQIESF
SPTCGTVTGGEEMLITGQNINPESTVVFLEKGSDGKTQWEFDVRALQEKSQNTSIVVKIP
PYYKKTTASSTQVQFYVSNGKKKRSASQFFTYLSAQVKQEFSIRTDLNTNDLAGQHPTTS
PAGLTTIGDPVASDKVQPLEQWLLSEGTVCAPSSSHLSYSPQDPLYLSHSHPADRSLNAE
ADLYPMFHPLLVDFSNSLYQKPQQDLSYKGQPSLPVAGGSLQGCKSLQILAEQPRSQLGK
GYQGIPSKQNHNLHNLGPASVSNTPMITSPNVNTSGLYAVDPVQFPHSSSSQVLPLSHQP
TLAKVPFNSPSVRKSLMDPQPFGASLQESIKSYNMSQGGERVTIKQNPKEEKELAFRSIG
LQDITLDDVSEIIVRDLFETPDSGNANSVP
NT seq 2973 nt   +upstreamnt  +downstreamnt
atgaccactaactacagagaggagctggacttcagactgatgtttggggagagcagttat
ccgtcttcgccgggccacgcagaatccagatcggatgatgatgccaactgctaccctctc
tttcctcctgggcctcaccatcccccagaacagcaggacagctatgcaaaccagtcttat
ggcacccctcaccctggttccctccaacccatggagtctcccagcagggtatttgactgt
cctagcatccaaatcacctctatcacagccaactgccaccaggacctgggtgcgcaccag
ttggacgagttggcaggtgcatgtggggaagccggtgctgggtctctatcaagggaccag
ctctttctgccattggatgcatcctacagggacacgtcctcactgtgtcccagcccctgc
agtagtttgtcctcccgcagctggttgtctgacgcctcgtcctgcgaatccttctcgcac
atctacgatgatgtggaggcagaactgaatgaggcagccgctcaagttcagctgtcttct
cctctagtgtcaccgctggcgtctcctctgccgtccccactaacttctccccaggcgtct
cctcaagtgtctcctcttgtgtccccctttggttctcctctggctgcatatggagatgac
ccttggtaccgttatcaacaacatcatcagcaacctctacaatatcattacgcccaatcg
ctgtcaccatatcagtcaccccgcaccagcatcactgaggaaacgtggctcagtccccgt
ccacaatcctcatcctcgcggccttcttctcggccaacctcgccatgtggaaaaaggcga
cattccagtgcagaggtcattcccggtttggcatctccgcacctttcccccaacgtaaca
ccgtctcactctcctcgggggagtgtcactgaggagacatggatgggaggtgccacattt
gccccctaccagacccctccactggaggtagacatcccatccaaaacaagaagaacgtat
cagaccaaccacaaccagcatcaagtggctctgttaccagagggctcaagtcttcaagac
ccaggtcttgcaaatccatcgctaaactcaggcatagccgtgtccctccccagtttaaag
aaagaggatatagtggaacatttcttagccgtcccaacacacccttgggttagatccaaa
caagtcagcactcctttatacaggtccacatctttacctccactggactctcctctgccc
aatcagtgtggccagtgtgagttaaaaattgagatccaacctaagcctcaccacagagcc
cattatgagacggagggcagtcgaggggccattaaatcagactgtggaaggcaccccgtt
gtaaagctaacagggtataatgaaaaacccgtcagcctgcagatgttcatcgggacagcg
gatgagcgttacatcaggccacacctattctatcaagtgcacaggattactgggaaaacc
gtcgcgacgccgagtcaagagacagtgatatcctgcaccaaagttcttgaaattcctctc
ctgcctgaaaacaatatgtgtgccagcattgactgtgctgggatcctgaagctacggaat
tcagacatcgagctgcggaaaggagagacggatatcgggcgtaaaaacacacgtgtgcgt
gctgtgttccgtgttcatatccctcaacacaatggaaaagtgctgtcactgcaggtggcg
tccatgcctatagaatgctctcaacgattagctcaggaacttccccaaatcgagagcttt
agtcccacctgtggtactgtgactggaggagaagagatgcttataacaggccaaaacatc
aatccagagtcaacagttgtcttcctagaaaagggctctgatggtaaaacacaatgggag
ttcgatgtgagggctctacaagaaaagagtcaaaatacaagcatagtggtaaagattcct
ccgtactacaagaaaaccacggcttcctccacccaggtgcagttctatgttagcaatggc
aagaagaagagaagtgcctcacagttcttcacctatctttcagcgcaggtcaagcaggag
tttagcataaggacggaccttaacaccaatgaccttgcagggcagcatcctaccacctcc
ccagcaggtctcaccactattggagacccagttgcttcggacaaagtccagcctcttgag
cagtggctgctgtctgaagggacagtctgtgctccatcttcaagccatctcagttactca
cctcaggatcctctgtatctgagccactctcatccagcagacagaagcctcaatgctgaa
gcagacctctaccctatgttccaccccttattggtggatttcagcaactctttgtaccaa
aaacctcaacaagatctgtcttacaaagggcaacctagtcttccagtggctggtggttca
ctgcaaggctgcaagtcactccaaatcttagcagagcaaccaaggtctcaactaggcaaa
ggataccaaggcattccttcaaaacaaaatcataatctccacaaccttgggcctgcctca
gtgtccaatacacccatgataactagcccaaatgtgaatacatctggtctgtatgcagtg
gatccagtgcaattcccacactcctcgtcttcccaggtgcttcctctttctcatcagcct
actcttgccaaagtgccttttaactcaccgtctgtcagaaagagtttgatggaccctcag
cctttcggtgcatctcttcaggagtccatcaaaagttacaatatgtcacaaggtggagaa
cgcgtcaccattaaacagaatccaaaggaagagaaagagctagcctttcggtccataggc
ctacaggatatcactcttgatgatgtaagtgaaatcattgtaagagacttgtttgagact
ccagattcagggaatgccaacagtgtgccgtag

KEGG   Sinocyclocheilus grahami: 107587592
Entry
107587592         CDS       T04918                                 

Definition
(RefSeq) nuclear factor of activated T-cells, cytoplasmic 2-like
  KO
K17332  nuclear factor of activated T-cells, cytoplasmic 2
Organism
sgh  Sinocyclocheilus grahami
Pathway
sgh04218  Cellular senescence
sgh04310  Wnt signaling pathway
sgh04370  VEGF signaling pathway
sgh04625  C-type lectin receptor signaling pathway
Brite
KEGG Orthology (KO) [BR:sgh00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    107587592
   04370 VEGF signaling pathway
    107587592
 09140 Cellular Processes
  09143 Cell growth and death
   04218 Cellular senescence
    107587592
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    107587592
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:sgh03000]
    107587592
Transcription factors [BR:sgh03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   RHR (Rel homology region) NF-AT
    107587592
SSDB
Motif
Pfam: RHD_dimer RHD_DNA_bind TIG
Other DBs
NCBI-GeneID: 107587592
NCBI-ProteinID: XP_016130918
LinkDB
Position
Unknown
AA seq 819 aa
MSNLYENIDGQEELDFPLLFLYNQPGNDFPPDDQVDDAGIPSSHGTNQTSPIVHQDHSLY
DEESVSQLSHHLPTDDLLTYGQSDLRHSFGHSSFLASHAGALQGNGPRIEITCPDLYQHD
HVHTNPVNISRPMLDIPYRESQCLSPASSTSSTSWHSDGYSPGTYSPCISPGVGEGTLAG
LTEAVLCPMMQAIQASGSPNTSPRTSITEDTVLDRRPTSPRSRSASPQGKRTYAEYETQR
SQSPRFGRDEPAEFYPLANLEDSMNSLCNSLTKPVPTKIVRPNLEYSVYTESQVGMFPIM
TEVKKEFTMESCYFMPANWSSQALPGVCSMPVAALPALDWPLPSSTEQYELRIEVQPRQH
HRAHYETEGSRGAVKASAGGHPVVQLRGYTGTEPLALQVFIGTADDRNLRPHAFYQVHRI
TGKTVTTSSQERMLNGTKILEVPLEPKESMRAVVDCAGILKLRNADIELKKGETDVGRKN
TRVRLVFRVHVPQPGGQWISLQVSSQSVECSQRTTHEQPAVERQDVDHCSVLGAPQMILR
GQNFTSESKVIFFEKTHVDLQIWEAEAKVYRDKCTSNLLFLEIPPYRDPNIYHPVKVKFH
VLNGKKKCSQPQNFTYTPLSVPQIKAEPVEEYQYAQLDCTGRPIMGVSPPSCHLADGCMM
PIGPPYQRAHCMYTAAPQHTPIRYPLDHTVPGVFAGSPAHASCVAASHSATSVSTFVPNT
YQHTIAGNSIQTTASLFPTLDVSELCSAAAHQKAYGSRTSPTTGRSPPARSHQQTYLPVQ
HQRNVSPVRVTIKQENLDQAYLDDVNAVIRKDLVHKNNL
NT seq 2460 nt   +upstreamnt  +downstreamnt
atgagtaatttatacgaaaatatcgacggtcaagaagaactggactttccactacttttc
ttgtacaaccaacctggcaatgacttccctccagatgaccaagttgacgacgctggcatc
ccctccagccacggtaccaatcagacttccccaatcgtacatcaagaccattctctgtac
gatgaggagtctgtgtcccagctgtcccaccatctccccaccgatgacctcctcacctac
gggcaatccgatctcaggcactctttcgggcactcctcctttcttgccagccacgctgga
gcgctccaaggcaacggcccgagaattgagatcacctgccctgacctgtaccagcatgac
catgtccacaccaaccctgtgaacatcagtcggcccatgctcgacatcccttacagggag
agccaatgcctcagtccggctagtagcacgtcctctactagctggcattcggatggctat
tctcctggaacatactccccctgcatctctcccggtgttggtgaaggaacgctagccgga
ttgaccgaagccgtcctttgcccgatgatgcaggccatccaagcgtcggggtctcccaac
acgtcccctcgcaccagcatcacagaagacaccgtcctggaccgccgtcccacctctcca
cgttcccgctcggcttctccgcaggggaagcgcacttacgccgaatacgagacacagaga
tctcaaagcccccgttttggccgagacgagcccgccgagttctatcccctggcaaacttg
gaggattccatgaacagcctctgcaacagcttgactaaaccagtccctactaagattgtc
cgacctaatctagagtattctgtctacacggaaagccaggtgggcatgttcccaattatg
acggaagtgaaaaaagaattcactatggaatcttgctatttcatgcctgccaactggtcc
agtcaggctcttccaggggtttgtagtatgccagtggctgccttgcctgcgctggactgg
cctcttcccagcagcactgagcagtatgagctcaggatagaggttcaacccagacaacac
caccgggcccactacgagacagagggcagccgaggggccgtcaaagcatctgccggaggc
catcctgtcgttcagttgcgagggtacaccgggacggagccgctggctctacaggtcttc
atcggcacggctgacgacaggaacctcagacctcacgccttctaccaggtccaccgcatc
accggcaagaccgtcaccaccagcagtcaggaacgaatgctgaacggaaccaagatccta
gaggtgccactggaacccaaggagagcatgagagctgtagttgactgcgctggtatcctg
aaactaagaaatgccgacattgagctgaagaaaggagagacggatgtgggacggaaaaac
acacgagtgagattggtcttccgtgtccacgttcctcaacccgggggccagtggatctct
ctccaagtgtcctcgcaatctgttgaatgctctcaaaggaccactcatgagcagccagca
gtagagcgtcaggacgtggaccactgttcggttctgggtgcaccacagatgatccttagg
ggccagaacttcacatcagagtccaaagtgatcttctttgagaaaacacatgttgacttg
cagatatgggaggctgaggcgaaagtttacagagacaaatgcacgtctaacctgctgttc
ttggaaatccctccgtatcgagaccccaacatctaccacccagtcaaagtcaaatttcac
gtgctgaatgggaagaagaaatgcagccagcctcaaaacttcacctacacgcccctctca
gtgccacagattaaagcggagccggttgaagaataccagtatgcacagttagactgtact
ggccgtcccatcatgggcgtctctcctccctcttgccatcttgcggacggttgcatgatg
ccgatcggcccgccgtaccagcgagctcactgcatgtacactgctgccccacaacacaca
cccatccgctacccgctggatcacacggtgccaggagttttcgccggctccccggctcat
gcttcctgcgtggcggcctcacacagcgccacctctgtgtctacatttgtgccaaacacc
taccagcacaccatagcaggtaacagcatccaaacgaccgcctctctgtttcccaccctc
gatgtctcagagctctgctccgctgcggcccatcagaaggcgtatggctcgaggacatcc
ccaaccacagggagatcccctccggcccgcagccatcagcagacatacctgccagtgcag
caccagagaaacgtcagtcctgtgagagtcaccatcaagcaggagaacctggatcaggcc
tatctggatgatgtgaatgctgttataagaaaggaccttgttcataaaaataatctctga

KEGG   Sinocyclocheilus grahami: 107590470
Entry
107590470         CDS       T04918                                 

Definition
(RefSeq) nuclear factor of activated T-cells, cytoplasmic 2-like isoform X1
  KO
K17332  nuclear factor of activated T-cells, cytoplasmic 2
Organism
sgh  Sinocyclocheilus grahami
Pathway
sgh04218  Cellular senescence
sgh04310  Wnt signaling pathway
sgh04370  VEGF signaling pathway
sgh04625  C-type lectin receptor signaling pathway
Brite
KEGG Orthology (KO) [BR:sgh00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    107590470
   04370 VEGF signaling pathway
    107590470
 09140 Cellular Processes
  09143 Cell growth and death
   04218 Cellular senescence
    107590470
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    107590470
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:sgh03000]
    107590470
Transcription factors [BR:sgh03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   RHR (Rel homology region) NF-AT
    107590470
SSDB
Motif
Pfam: RHD_dimer RHD_DNA_bind TIG
Other DBs
NCBI-GeneID: 107590470
NCBI-ProteinID: XP_016134705
LinkDB
Position
Unknown
AA seq 900 aa
MSSFYGDKAAIGLAEELSQVHCQDELEFDYLFEYGTTTDLQDEQSISSHKDLISPPGLSY
PVEEAQAYGIKPCAASFAELNEAFSGYEQLEPKSFLENARPNSQALSPRIEITPSREHYS
HGRDSLQNHLLNTSPSPGLTVPGHDPLAYREPQCLSPASSNSSTSWHSENHSPWASPCVS
PSNSQAAGELCPRLQGIHTGSPRTSPGTSPRSSLAEDCCVGPRSPSPRPGSRSTSPLCKR
TYDMYRNLVPVARSRSPSPHGGHEEHHAPHYGSNNISGVMNGFGIAQASSIPTKIVKTNQ
QAYPLYPENHTDSYLVSCDQEVKTKPGPEPFFVIPQIWPNQLMPGICSIPVASLPPLEWP
LPSRTDQYELHIEVQPKPHHRAHYETEGSRGAVKAPTGGHTVVQLRGYRGKEPLGLEIFI
GTADERILKPHAFYQVHRITGKTVTTTSYEKIISSTKVLEIPLEPKNNMKAIIDCAGILK
LRNADIELRKGETDIGRKNTRVRLVFRVHIAQQGGQHVSLQVASHPIECSQRSAHELPMV
EKQDMAACSVLGGQQMILTGQNFSADSKVIFMEKTHDGQQIWELEATVDKDKSQTSMLFI
EVPPYRDPSICHPAKVNFYVINGKRKRSQPQHFTYMPLPVPSIKTEPVDEYESGRMGYSM
SQMLGVSPQPYYNPRGVITPDSGLVPGLVPCQQTRLGVSPPDHRFQQQSPAIMYSHPGKS
LSSSPIYSQTGATMIPDSHRSVLVHTGSPAQSSHLAGQHPSNQHPSIIQFSPTNHHLLRG
GDPPAPPPPEHQHIIYCEGYNQHGPQATGANRSPAPAQAPQQPQNYPTVIQQQPFLQRVA
KDRSPPVQVEPQRCSSTDEQRTSVPGRVTVKQENLDQAYLDDVNEIIRKDLTGVPGRGQT
NT seq 2703 nt   +upstreamnt  +downstreamnt
atgagctctttttacggcgataaggctgcgataggactggctgaggagctcagtcaggtg
cactgtcaggatgagctggagtttgactatctctttgagtatggaaccacaaccgacctt
caagatgagcaaagcatctcctcgcacaaagacctcatctctcctcccggcctctcctat
cctgtggaggaagctcaagcgtacggcatcaagccgtgtgcggcttccttcgccgaactc
aacgaagcattctctggctatgagcaactggagccgaagagcttcctggagaacgccaga
cccaacagccaagccctgagcccccgaatcgagatcacgccttcccgtgagcactacagc
catggacgagactcgctccagaaccatctcttgaacaccagccccagtcccggtctcacc
gtgcctggtcacgaccctttggcctaccgggagccgcagtgcctgagtcccgccagcagc
aactcatccacctcctggcactcggagaaccactcgccttgggcttccccttgcgtttcg
cccagcaatagccaagcagctggagaactttgccctagactccagggcatccacacgggt
tcccctcgcaccagtccgggcacttctccgcgaagcagcctggccgaggactgctgcgtg
gggccgcgttctccttcgccccggcccggctcgcgatccacctctcctctatgcaaacgc
acctacgacatgtacagaaacctggttccggtggcccggtcacgcagcccgtcgccccac
ggtggccacgaagagcatcacgccccccattatggctccaataacatctcaggggtgatg
aatgggtttggcatcgcccaagctagttccattcctaccaaaatcgtgaagaccaaccag
caggcctacccgctttacccagagaaccacactgatagttacctggtgtcatgtgaccag
gaagtgaagaccaaacctggccctgaaccgttcttcgtaatccctcaaatctggcctaat
cagctgatgccgggaatatgcagcatcccagtggcttccttgcccccgctggagtggcct
ctgcccagccgcaccgatcagtacgagctccacatcgaggtgcagcccaaaccacaccac
agggctcactatgagaccgagggcagccgcggggcggtcaaagcccccaccggtggtcac
acggtggtccagttacgtggatacaggggcaaggagccgctgggtttagagatcttcatt
ggcacggcagacgagcgaatcctgaagcctcacgctttctatcaggtccatcgcattacc
ggcaaaaccgtcaccaccaccagctacgagaagatcatcagcagcaccaaagtcctggag
attcctctcgagccaaagaataacatgaaagcaataattgattgcgctgggattctcaag
cttcgcaatgccgacatcgagctgcggaaaggggagacggacatcgggcggaaaaacacg
cgtgttcgactggtattccgtgttcatattgcccagcaaggaggccaacatgtgtctctg
caggttgcttcacatcccatcgaatgctcccagaggtctgcccacgagctgcccatggta
gaaaagcaggacatggccgcctgttcggttcttggaggccagcagatgattctcaccggc
cagaacttcagcgcagattcaaaggtgattttcatggagaagactcacgatggacagcaa
atttgggaattggaagccacagttgacaaagacaaaagccagacaagcatgctgttcatt
gaagtgcctccgtatagagacccatccatttgccatcctgccaaagtcaacttctacgta
ataaatgggaaacggaagcgcagtcaacctcagcatttcacctacatgcctctaccagtt
ccctctattaagacagagccagtggatgaatatgaatctggtcggatgggttattccatg
tcacaaatgctgggggtgtctccacagccatactataaccctcgcggggtcatcacccca
gacagtggcctggtgcctgggctcgtcccctgtcagcagacccgcctgggtgtctcccct
ccggaccaccgatttcagcagcagagcccagccataatgtactcccatcctggaaagagc
ttgtcaagcagtcctatttactctcagacgggagccactatgattccagactcccatcga
tcagttctggtccacacaggttccccagcccagtcctctcatctggctggccagcatcct
tccaaccagcatccctcaatcatccagttctctcccaccaaccaccacctgctcagaggt
ggagatcctcctgcgccaccacccccagaacatcaacacataatttattgtgagggctac
aatcagcatggtcctcaagccacaggggcaaaccgttcaccagcaccagcccaggcacct
cagcagcctcagaattacccaacagtcatccaacaacagcccttcctccagagagtggcc
aaagacaggtcaccacctgtccaagtagagccccagagatgttcctcgacggacgaacag
agaaccagcgttcctggacgagtcacagtcaagcaggagaacttggaccaggcctacctt
gatgatgtgaatgagatcataaggaaggatctgacaggagtgcctggcaggggtcagaca
tag

KEGG   Sinocyclocheilus grahami: 107591355
Entry
107591355         CDS       T04918                                 

Definition
(RefSeq) nuclear factor of activated T-cells, cytoplasmic 4-like isoform X1
  KO
K17334  nuclear factor of activated T-cells, cytoplasmic 4
Organism
sgh  Sinocyclocheilus grahami
Pathway
sgh04218  Cellular senescence
sgh04310  Wnt signaling pathway
sgh04625  C-type lectin receptor signaling pathway
Brite
KEGG Orthology (KO) [BR:sgh00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    107591355
 09140 Cellular Processes
  09143 Cell growth and death
   04218 Cellular senescence
    107591355
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    107591355
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:sgh03000]
    107591355
Transcription factors [BR:sgh03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   RHR (Rel homology region) NF-AT
    107591355
SSDB
Motif
Pfam: RHD_DNA_bind RHD_dimer TIG
Other DBs
NCBI-GeneID: 107591355
NCBI-ProteinID: XP_016135983
LinkDB
Position
Unknown
AA seq 870 aa
MGAAPGSGWEEGEFEFKLVFEEDPPRQSCCGPEDTDSGQTHREPADTHLTSALAGQPVSI
PPPAGRRAGMHSPPPRRAFVREFSGTYESLPARSIQVSESRVLECPSIQITTISPEDDSG
PVGGSYWDGGGGWDRERLYLPLLDSYRDVMTGAGSLSPSPSPASSSSSRGWLSPASSCDS
LLVEEDELNEAAAHFCLSPSSRPTSPGGKKRRSSPLASPSTSRRSSYSEDLSSLPDMGET
LAQSQAPASCELNIPQKTRKTSLEQMSSRDIEPELTPIQTSPCPLPEVAQLRREPPTIGM
DYLSVPPALGWGRTRASAHSPLFRSNALPPLDWPLPSQFDQYELRIEVQPRPHHRAHYET
EGSRGAVKASPGGHPVVKLVGYTERQPLSLQVFVGTADDRSIRPHPFYQIHRVTGKMVGT
ASQESIQAGTKLLDIPLNPENSMTALIDCAGILKLRNSDIELRKGETDVGRKNTRVRLVF
RTHLPLSPPIVPPGRVLALQVASLPIECSQRSAQELPVVESISLTSCSTEGGEELLLGGT
NFLPTSRVFFMERGSDGKVQWEEEAHVDRDKSNENLLCVQVPAYNDLSLNHPVSVCLYVS
NGKRKRSSTHCFKYLPIMFKEEDPLLSHPSILPLEGVTLSPMGSGSIVDMSSDLSADDRS
MSFHLPPYPNEYPYSSHGYQEDYCHKPEVPEDGGGRGALTERHPSFESLELGFTELLPPM
YPRASQPLSPSPSPSPWLDSPYLSSSPSPSHSCSLSPFPASSPISTSPLPPLSHSPYPHC
PCPQEMCSSPPSNTSHYQDLCPPPYGRYESWEHQMRPSERDIGPGLKLEGPPDFSGPTPM
QHITLEEVTEFIGEDIRSFQMGSHMDSRPG
NT seq 2613 nt   +upstreamnt  +downstreamnt
atgggggccgcgccgggctcgggatgggaagagggagagttcgagttcaagctcgtgttc
gaggaggatccgccgcgccagagctgctgcggcccagaagacaccgacagcggccagacg
caccgtgagccagccgatacccacttgacttccgcactggctggccaacccgtgagtatc
ccaccgccagccggtcgcagggctgggatgcattccccaccccccagacgggccttcgtc
agggagttcagtgggacttatgagagtctaccagcaagatcaatacaggtatcagagtct
agagtgcttgagtgccccagcatccagatcaccactatctcccctgaagatgactcaggt
ccagtggggggaagttactgggatggcgggggtggctgggacagggagcgcctatacctg
cccctgctggactcttaccgtgacgtcatgacaggggcaggttccctcagtcccagcccc
agccctgcttccagttcctcatctcgtggatggctgagtccagcttccagctgtgattct
ctcctggtggaggaggatgagctcaacgaagctgctgcccacttctgcctatcgccctcc
tcacgccccacgtctcctgggggcaaaaagcgcaggagctccccactggcctcccccagc
acctcccgcagaagcagctactccgaggatctctcctccctcccggacatgggagaaacc
ttggctcagtctcaggctccagcaagctgtgagctcaacatcccacagaagaccaggaag
acctctctggaacagatgtcatcaagagacatcgaaccagagctgacccccattcagacc
tctccctgccccctcccagaggttgctcagctgagaagggagccccccacaatagggatg
gactacctgtctgtgcctcctgctctgggctggggcagaaccagggccagcgctcacagt
cctctctttagatctaatgcactgccgccacttgactggccgctgccttcacagtttgac
cagtatgaattgcgcatagaggtacagcccagaccacaccatcgtgcgcattatgaaact
gaaggaagtcgaggagcagtaaaggcatcaccaggaggccatccagtcgtgaagctggtg
ggttacactgaaaggcagccgctctccttacaggtgtttgtaggaactgctgatgacaga
tcaatacgtcctcatcctttttatcaaatacacagagtaacagggaagatggtaggcaca
gctagtcaggagagcatccaggctggcactaaactcctggacatcccactcaacccagag
aacagcatgactgccctcattgactgtgcaggtattctaaagctgaggaactctgacatt
gaactccggaaaggagagacagatgtagggagaaagaacactcgagtgcgtttggtgttc
cgcacacaccttcctctgtctccacccatcgtccctccaggacgagtcttagccctgcag
gtggcctctttacccattgaatgctcacagcgctctgcacaggagcttcctgtagtggag
tctatcagtcttacttcctgttcaacagagggaggcgaggaactacttctaggtgggacc
aactttctacccacctccagagttttctttatggagagaggatcagatggcaaagtccag
tgggaggaggaggcacatgtggacagggacaaaagcaatgagaatttgctgtgtgtacaa
gtgccagcctataatgatctttcactgaaccacccagtgtctgtctgcctgtacgtgtcc
aatgggaagaggaagaggagcagcacgcactgctttaaatatctgcccatcatgtttaaa
gaagaagatccgctgctgtcccatccctccatcttgcccctggaaggggtgacgctttcc
cccatggggagcggcagcattgtcgacatgagttcagacctatccgcagatgacagaagc
atgtctttccacctacctccatatcccaatgagtacccttactcctcgcatggctaccag
gaggactactgccacaaaccggaggtccccgaggacggtggaggtcgaggtgctctgacc
gaaaggcatccaagctttgagagcctggagctgggcttcacagagcttcttcctcccatg
tacccaagagcctcacaacctctttccccctccccgtctccctctccgtggcttgactct
ccctatctttcctcctcaccttctccctcacactcttgctctctcagcccattccctgca
agcagtcccatctccacctcgccccttcctccactctctcactccccatatccacactgt
ccttgcccccaagagatgtgctcctcgcctccgtcaaacactagccactatcaggacctg
tgcccacctccgtacggccgatatgagagctgggagcaccagatgcgtccctctgaaaga
gacataggccctggtctgaagctggagggacccccggacttctcgggccccacacccatg
cagcatatcacactagaggaagtgactgaattcattggagaggatataagatcctttcag
atggggtcacacatggatagtcgacctggatga

KEGG   Sinocyclocheilus grahami: 107592032
Entry
107592032         CDS       T04918                                 

Definition
(RefSeq) nuclear factor of activated T-cells, cytoplasmic 1-like
  KO
K04446  nuclear factor of activated T-cells, cytoplasmic 1
Organism
sgh  Sinocyclocheilus grahami
Pathway
sgh04010  MAPK signaling pathway
sgh04218  Cellular senescence
sgh04310  Wnt signaling pathway
sgh04625  C-type lectin receptor signaling pathway
Brite
KEGG Orthology (KO) [BR:sgh00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    107592032
   04310 Wnt signaling pathway
    107592032
 09140 Cellular Processes
  09143 Cell growth and death
   04218 Cellular senescence
    107592032
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    107592032
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:sgh03000]
    107592032
Transcription factors [BR:sgh03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   RHR (Rel homology region) NF-AT
    107592032
SSDB
Motif
Pfam: RHD_dimer RHD_DNA_bind TIG
Other DBs
NCBI-GeneID: 107592032
NCBI-ProteinID: XP_016136875
UniProt: A0A672SUL2
LinkDB
Position
Unknown
AA seq 870 aa
MKSAEEDAYGYSQNTSISLPLSNPCPPSQYHNLQSSPSLSMSISQPSSFPPQDDMSSVGY
FQTSGTRSNGAPTLESPRIEITAYGQFPEDEVEENSVPVAKRVNSIVTLTLPSIDGYRDP
TCLSPASSVSSRSCHSDASSYESGFSYNYDNSPQNSPWQSPCVSPKGSSSLQSCTLGASP
RHSPSGSPRTSITDDSWVGTRGSRPNSPCVGKRKYSFNGGPSHKYHPYSPNQSPGLSPQT
SPRLSVTEDTWLPNTNQYTNSAIVAAINALTTDGLTDLGEGIPLKSRKTSLEHSTSMNLK
VEPGGEEIGSLELCQEDFSSARLPFKKETYCSGFLDVPQHPYWSKPKPYISPSLPALDWQ
LPSSSGPYRLQIDVQPKSHHRAHYETEGSRGAVKALAGGHPVVQLHGYMESEPLTLQLFI
GTADDRLLRPHAFYQVHRITGKTVSTPSHEAIQSNTKVLEIPLLPESNMRAIIDCAGILK
LRNSDIELRKGETDIGRKNTRVRMVFRVHINQPNGRMVSLQVASNPIECSQRSAQELPLV
DKQNMESCAASGGEQMLLSGHNFQHDSKVVFVERAQDGHHIWEMEAKVNRESSKSVALLV
DVPPYRNQRISNPVQVNFYVCNGKRKRSQYQRFTYLPTNVPTIKTEPHDDYDLPQVCVPL
HPSGLVLHPKPYYSPPAMTPMMPSELRPCVTGSFTSSPQRLVAKPTSLSCSSSPSTSPKL
QDLSPPHLSSKCLSARSNLGPQSPTVPHVSTIQPTPGRYPQSILYPTGSAASSPGSHPST
PNSAPELPFTPSHSLTQSQATSEASALAAQITKGPVRSGSSPLLQEEGDASTMLTVNIKQ
EPQELDQMYLDDVNEIIRNDLSCISVHSHA
NT seq 2613 nt   +upstreamnt  +downstreamnt
atgaaatccgcagaggaagatgcatacggttacagccaaaacaccagcatctcattacct
ctgagcaacccctgcccaccctcccagtaccacaatctccagtccagcccttccttgtcg
atgtccatcagtcagccgtcctcgttcccccctcaagatgacatgagctcagtgggttac
ttccaaacatccggcacccggtccaacggggctcccacgctggagagtccacgcattgag
ataacagcttacgggcagttcccagaggacgaagtggaggagaacagcgttcccgtggcc
aagcgagtcaattccatagtgacattaactttgccaagcattgacggttatcgtgacccc
acctgcctaagcccggcaagcagcgtgtcttcccgtagctgccattcagatgcgtcatcg
tacgaatcaggcttttcgtacaactatgacaactcgccgcagaactcgccctggcagtct
ccctgtgtctccccgaaaggttcctcctctctgcagtcctgcaccctcggcgcttctcca
cgccattctccgtctggttctccccgtaccagtatcaccgacgacagctgggtgggcacc
cgaggctcacgaccgaattctccttgtgtcggtaaacggaagtacagcttcaacggtggc
ccatcacacaagtaccatccgtactcaccgaatcaatccccggggctgtcgccacaaact
tcgccccgtcttagcgtgacggaggacacctggctgcccaacaccaaccagtacaccaac
tccgccattgttgccgccattaatgccctcaccacagatggattaacagatcttggggag
gggatccctttgaagtcccgcaagaccagtctggagcacagcacctcgatgaacctgaaa
gtagaaccaggtggagaggagataggatccctggagctttgccaggaggacttctcctcc
gcacgcctgcccttcaaaaaagagacctactgcagtggcttcttggatgtgccccaacac
ccatattggtccaagccgaagccttacatcagtccatcgctgcctgctctcgattggcag
ttgccttccagttcagggccgtaccgcctacagattgatgtccaacccaagtcccatcac
cgtgctcactacgagactgaaggcagcagaggggctgtaaaagcactagcgggagggcat
ccagtggtccagcttcacggctacatggagagtgaacctctgaccctacagctgttcatt
gggacagcagacgaccgtcttctccggcctcacgccttctaccaggtccaccgtataact
gggaagaccgtgtccacaccaagccacgaggccatacagtccaacaccaaagttcttgag
attcctctgcttcctgagagcaacatgagggccataatcgactgcgctggaattctcaag
ctgcgtaactcagacatcgagctccggaagggcgagacagacatcggacggaagaacaca
cgtgtgaggatggtgttccgtgtccacatcaaccaacctaatggcaggatggtgtcctta
caggtggcatctaaccccattgagtgctcccagcgctcagcacaggagctgcccctcgtg
gataaacaaaacatggaaagctgtgccgcctcagggggggaacagatgcttctcagcggg
cacaacttccagcacgactccaaggtggtgtttgtggagcgagcacaagatggccaccac
atatgggaaatggaggccaaagtcaacagagaatcatccaaatctgtggctttgcttgtg
gatgtcccaccataccggaaccaaagaatatccaacccagttcaagtgaatttctatgtg
tgcaatggcaaacggaagagaagccagtaccagcgtttcacatacctgcccacaaacgtt
ccaaccataaaaacagagccgcacgacgactacgacctcccccaggtatgtgtgccgctc
catccctctgggttggtgctgcatccaaagccctactacagccccccggcgatgacaccc
atgatgccctcagaactaaggccttgtgtcacgggctccttcacatccagccctcagaga
ctggtggcaaaacccacctccctgtcctgctcgtcctcccctagcaccagccccaaacta
caggatctttccccgcctcacctctcctctaagtgcctatcagcgagatcgaaccttggc
ccccagtctccaacagtcccacacgtctccaccatccagcccacacccggacgctacccg
cagtccatcctctacccaacaggaagcgccgcatcctctccagggtcccatccttccacc
ccaaactccgcaccagaactccccttcactcccagccacagtctgacccaatcacaagcc
accagcgaggcctctgcattagcagctcagataaccaaagggccggtgaggagcgggtcc
tcccccctcctacaggaggagggagacgcctccaccatgctgactgtcaacatcaagcag
gaaccacaggaactggatcaaatgtacctagatgatgttaacgaaatcatcaggaacgat
ctctcctgcatctccgttcacagccacgcatag

DBGET integrated database retrieval system